US 9,937,249 B2Grant
Mesoporous silica compositions for modulating immune responses
Issue Date:2018-04-10
•38 Claims
•28 Drawing Sheets
Abstract
A composition comprising mesoporous silica rods comprising an immune cell recruitment compound and an immune cell activation compound, and optionally comprising an antigen such as a tumor lysate. The composition is used to elicit an immune response to a vaccine antigen.
Metadata
Assignee
- President and Fellows of Harvard College
Inventors
- Jaeyun Kim
- Weiwei Aileen Li
- David J. Mooney
Application Information
Application Number:US 14/394,552
Filing Date:2013-04-16
Priority Date:2012-04-16
Art Unit:1647
Classifications
IPC:
A61K39/00A61K9/16A61K38/18A61K38/19A61K39/39A61K9/00
Patent Drawings (28 sheets)
Description
Government Support
[0001] This invention was made with Government support under Grant No. R01DE019917 awarded by the National Institutes of Health. The Government has certain rights in the invention.
Field of the Invention
[0002] This invention relates to biocompatible injectable compositions.
Background of the Invention
[0003] Vaccines that require ex vivo manipulation of cells, such as most cell based therapy, lead to poor lymph node homing and limited efficiency.
Summary of the Invention
[0004] The invention provides a solution to problems and drawbacks associated with earlier approaches. Accordingly, the invention features a composition comprising mesoporous silica (MPS) rods comprising an immune cell recruitment compound and an immune cell activation compound. The rods comprise pores of between 2-50 nm in diameter, e.g., pores of between 5-25 nm in diameter or pores of between 5-10 nm in diameter. In preferred embodiments, the rods comprise pores of approximately 8 nm in diameter. The length of the micro rods ranges from 5 μm to 500 μm. In one example, the rods comprise a length of 5-25 μm, e.g., 10-20 μm. In other examples, the rods comprise length of 50 μm to 250 μm. Robust recruitment of cells was achieved with MPS microparticle compositions characterized as having a higher aspect ratio, e.g., with rods comprising a length of 80 μm to 120 μm.
[0005] Exemplary immune cell recruitment compounds include granulocyte macrophage-colony stimulating factor (GM-CSF). Other examples of recruitment compounds include chemokines, e.g., a chemokine selected from the group consisting of chemokine (C-C motif) ligand 21 (CCL-21, GenBank Accession Number: (aa) CAG29322.1 (GI:47496599), (na) EF064765.1 (GI:117606581), incorporated herein by reference), chemokine (C-C motif) ligand 19 (CCL-19, GenBank Accession Number: (aa) CAG33149.1 (GI:48145853), (na) NM_006274.2 (GI:22165424), incorporated herein by reference), as well as FMS-like tyrosine kinase 3 ligand (Flt3) ligand; Genbank Accession Number: (aa) AAI44040 (GI:219519004), (na) NM_004119 (GI: GI:121114303), incorporated herein by reference)
[0006] Immune cell activating compounds include TLR agonists. Such agonists include pathogen associated molecular patterns (PAMPs), e.g., an infection-mimicking composition such as a bacterially-derived immunomodulator (a.k.a., danger signal). TLR agonists include nucleic acid or lipid compositions [e.g., monophosphoryl lipid A (MPLA)]. In one example, the TLR agonist comprises a TLR9 agonist such as a cytosine-guanosine oligonucleotide (CpG-ODN), a poly(ethylenimine) (PEI)-condensed oligonucleotide (ODN) such as PEI-CpG-ODN, or double stranded deoxyribonucleic acid (DNA). For example, the device comprises 5 μg, 10 μg, 25 μg, 50 μg, 100 μg, 250 μg, or 500 μg of CpG-ODN. In another example, the TLR agonist comprises a TLR3 agonist such as polyinosine-polycytidylic acid (poly I:C), PEI-poly (I:C), polyadenylic-polyuridylic acid (poly (A:U)), PEI-poly (A:U), or double stranded ribonucleic acid (RNA). Lipopolysaccharide (LPS) is also useful for this purpose.
[0007] To generate an immune response, the composition comprises an antigen to which the immune response is desired. For example, the composition comprises a tumor antigen. In preferred embodiments, the antigen comprises a tumor cell lysate (e.g., from a tumor biopsy sample that was taken from the subject to be treated). The subject is preferably a human patient, but the compositions/systems are also used for veterinary use, e.g., for treatment of companion animals such as dogs and cats as well as performance animals such as horses and livestock such as cattle, oxen, sheep, goats, and the like.
[0008] Antigen presenting cells such as dendritic cells (DC's) traffick through the MPS device, i.e., the cells do not stay in the device permanently. The immune cells are recruited to the device and are present in the device temporarily while they encounter antigen and are activated Immune cells such as DC's then home to a lymph node. They accumulate in a lymph node, e.g., a draining lymph node, not in the MPS device. The accumulated cells in the lymph node further augment the immune response to the vaccine antigen resulting in a strong cellular and humoral response to the antigen.
[0009] Thus, a method of inducing a systemic antigen-specific immune response to a vaccine antigen, comprises administering to a subject the MPS composition described above. The composition is loaded into a syringe and injected into the body of the recipient. For example, a small amount (e.g., 50-500 μl, e.g., 150 μl) is administered subcutaneously. Typically, the device (MPS composition) is infiltrated with cells by Day 2 post-administration, and by Day 5-7, a draining lymph node is swollen with cells that have migrated out of the device and to the lymph node tissue, where they accumulate and further propagate an antigen-specific response. The compositions are therefore useful to induce homing of immune cells to a lymph node. The MPS composition need not be removed after vaccination therapy. The composition may remain in the body at the site of administration, where it degrades. For example, the MPS particles are consumed by macrophages over time and then cleared from the body.
[0010] A method of making a vaccine comprises providing a suspension of mesoporous silica rods, contacting the rods with a vaccine antigen, an immune cell recruitment compound, and an immune cell activation compound. The vaccine antigen comprises a tumor cell lysate, the recruitment compound comprises GM-CSF, and the activation compound comprises CpG ODN. In some cases, the rods are modified with glycolic acid or lactic acid prior to contacting the rods with one or more of the following compounds: vaccine antigen, recruitment compound, or activation compound. Optionally, the MPS composition/device is fabricated with MPS rods, an immune cell recruitment compound, and an immune cell activation compound (optionally, with glycolic or lactic acid modification), stored, and/or shipped to the site of use, whereupon the patient-specific tumor antigen preparation or lysate is added to the rod suspension prior to administration, e.g., 1, 2, 6, 12, 24, or 48 hours, prior to administration to the patient.
[0011] The compounds that are loaded into the MPS composition are processed or purified. For example, polynucleotides, polypeptides, or other agents are purified and/or isolated. Specifically, as used herein, an “isolated” or “purified” nucleic acid molecule, polynucleotide, polypeptide, or protein, is substantially free of other cellular material, or culture medium when produced by recombinant techniques, or chemical precursors or other chemicals when chemically synthesized. Purified compounds are at least 60% by weight (dry weight) the compound of interest. Preferably, the preparation is at least 75%, more preferably at least 90%, and most preferably at least 99%, by weight the compound of interest. For example, a purified compound is one that is at least 90%, 91%, 92%, 93%, 94%, 95%, 98%, 99%, or 100% (w/w) of the desired compound by weight. Purity is measured by any appropriate standard method, for example, by column chromatography, thin layer chromatography, or high-performance liquid chromatography (HPLC) analysis. A purified or isolated polynucleotide (ribonucleic acid (RNA) or deoxyribonucleic acid (DNA)) is free of the genes or sequences that flank it in its naturally-occurring state. Purified also defines a degree of sterility that is safe for administration to a human subject, e.g., lacking infectious or toxic agents. In the case of tumor antigens, the antigen may be purified or a processed preparation such as a tumor cell lysate.
[0012] Similarly, by “substantially pure” is meant a nucleotide or polypeptide that has been separated from the components that naturally accompany it. Typically, the nucleotides and polypeptides are substantially pure when they are at least 60%, 70%, 80%, 90%, 95%, or even 99%, by weight, free from the proteins and naturally-occurring organic molecules with they are naturally associated.
[0013] A small molecule is a compound that is less than 2000 daltons in mass. The molecular mass of the small molecule is preferably less than 1000 daltons, more preferably less than 600 daltons, e.g., the compound is less than 500 daltons, 400 daltons, 300 daltons, 200 daltons, or 100 daltons.
[0014] The transitional term “comprising,” which is synonymous with “including,” “containing,” or “characterized by,” is inclusive or open-ended and does not exclude additional, unrecited elements or method steps. By contrast, the transitional phrase “consisting of” excludes any element, step, or ingredient not specified in the claim. The transitional phrase “consisting essentially of” limits the scope of a claim to the specified materials or steps “and those that do not materially affect the basic and novel characteristic(s)” of the claimed invention.
[0015] Other features and advantages of the invention will be apparent from the following description of the preferred embodiments thereof, and from the claims. Unless otherwise defined, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. Although methods and materials similar or equivalent to those described herein can be used in the practice or testing of the present invention, suitable methods and materials are described below. All published foreign patents and patent applications cited herein are incorporated herein by reference. Genbank and NCBI submissions indicated by accession number cited herein are incorporated herein by reference. All other published references, documents, manuscripts and scientific literature cited herein are incorporated herein by reference. In the case of conflict, the present specification, including definitions, will control. In addition, the materials, methods, and examples are illustrative only and not intended to be limiting.
Brief Description of the Drawings
[0016] FIG. 1 is an SEM image of the MPS rods. The random stacking and self assembly of these rods generate a 3D space that allows for cell infiltration.
[0017] FIG. 2 is a bar graph showing surface marker expression dependent on MPS rods of different lengths. 100 μg of the MPS rods of different lengths were incubated with bone marrow derived dendritic cells for 18 hour. As a marker of inflammation, the percentage of activated cells was determined by staining for cell surface receptors CD11c (DC marker), MHCII (antigen presentation marker) and CD86 (costimulatory receptor). The inflammatory property of the rods increased with increasing length. Since a desired scaffold exhibits inflammatory properties (similar to the PLG scaffold control), rods between 30 and 100 μm or 120 μm were used in subsequent experiments.
[0018] FIG. 3 is a series of images showing the effect of MPS rods in a mouse. FIG. 3A is a picture depicting a scaffold injection site excised after 7 days after 5 mg of rhodamine labeled MPS rod was injected subcutaneously into a C57bl/6j mouse. The subcutaneous pocket indicates that the rods were localized and have self-assembled to create a 3D microenvironment. FIG. 3B is an SEM image of the excised scaffold site demonstrating cell infiltration into the scaffold site. FIG. 3C depicts live/dead imaging of the cells detached from the MPS scaffold, demonstrating the recruitment of living cells.
[0019] FIG. 4A is a line graph showing GM-CSF release from MPS rods. 1 μg of GM-CSF was loaded into the MPS rods and incubated in 0.1% BSA/PBS. Supernatant was collected periodically and measured for GM-CSF using ELISA (R&D). GM-CSF is being continuously released from the MPS rods. FIG. 4B is a bar graph showing surface marker expression in an in vitro bone marrow derived dendritic cell (BMDC) co-culture with MPS. 100 μg of the unmodified, amine-, thiol-, chloro- and phosphonate-modified MPS rods were incubated with 106/ml BMDCs for 18 hours. The cells were then analyzed for the expression of MHC class-II and the costimulatory molecule CD86. An increased expression of MHCII and CD86 of the BMDCs stimulated by MPS indicates that the MPS rods are inflammatory, and this property was modulated by surface-modifying the MPS rods.
[0020] FIG. 5A is a bar graph depicting recruitment of CDs by GM-CSF loaded MPS rods. 5 mg/mouse of MPS rods loaded with or without 1 μg/mouse GM-CSF were injected subcutaneously. Cells from the scaffold site were retrieved and stained for the CD11c receptor (DC marker). The MPS scaffold loaded with GM-CSF was capable of recruiting more DCs than the blank MPS scaffold. FIG. 5B is a bar graph depicting surface marker expression of DCs. The MPS scaffold loaded with GM-CSF and CpG-ODN activated more DCs than without CpG-ODN.
[0021] FIGS. 6A-B are bar graphs showing (FIG. 6A ) percentage of B220+ cells or (FIG. 6B ) total number of B220+ cells at the scaffold site. 5 mg/mouse of MPS rods loaded with or without 1 μg/mouse GM-CSF, 100 μg CpG-ODN and 130 μg ovalbumin were injected subcutaneously. Cells from the scaffold site were retrieved periodically and stained for the B220 receptor (B cell marker). The MPS scaffold loaded with GM-CSF, CpG-ODN and Ova was capable of recruiting more B cells by day 3.
[0022] FIGS. 7A-C are flow cytometry scatterplots (FIG. 7A ) and bar graphs (FIGS. 7B-C ) depicting the presence of the MHC-I-SIINFEKL (SEQ ID NO:1) marker on the surface of DCs. The MPS scaffold loaded with GM-CSF, CpG-ODN and the model antigen ovalbumin induced the expansion of antigen specific DCs homed to the draining lymph node (dLN). dLN cells are stained with the dendritic marker CD11c and the marker MHC-I-SIINFEKL, which indicates that a part of the ovalbumin protein, the peptide sequence SIINFEKL, is being presented on the surface of the cell in the MHC-I complex.
[0023] FIGS. 8A-B are bar graphs showing formation of the germinal center due to the MPS scaffold. The MPS scaffold loaded with GM-CSF, CpG-ODN and the model antigen ovalbumin was able to induce the germinal center, home to activated and antigen primed B cells, in the dLN. The dLN cells are stained with B220 (B cell marker) and GL7 (germinal center marker) to investigate the formation of the germinal center, which hosts only B cells that are activated and in the process of somatic hypermutation and isotype switching.
[0024] FIGS. 9A-B are bar graphs depicting that the MPS scaffold loaded with GM-CSF, CpG-ODN and the model antigen ovalbumin was able to induce the expansion of CD8+ cytotoxic T lymphocytes (CTLs) that can specifically recognize the model antigen. Splenocytes were stained for CD8 (killer T cell marker) and with a MHCI-tetramer-SIINFEKL antibody, which indicates whether a T cell is able to recognize a specific antigen presented on the MHCI complex.
[0025] FIGS. 10A-C are histograms showing that the MPS scaffold loaded with GM-CSF, CpG-ODN and the model antigen ovalbumin was able to induce the clonal expansion of antigen specific CD8+ CTLs in the dLN and the spleen. Injected splenocytes from the OT-I mouse were stained the cell tracker dye CFSE, whose fluorescence halves every time a cell divides. The lower fluorescence in the CFSE stained splenocytes in the spleen and the dLN in the fully loaded vaccine group indicates ova-specific CTL proliferation.
[0026] FIGS. 11 A-C are histograms showing that the MPS scaffold loaded with GM-CSF, CpG-ODN and the model antigen ovalbumin was able to induce the clonal expansion of antigen specific CD4+ THs in the dLN and the spleen. Injected splenocytes from the OT-II mouse were stained the cell tracker dye CFSE, whose fluorescence halves every time a cell divides. The lower fluorescence in the CFSE stained splenocytes in the spleen and the dLN in the fully loaded vaccine group and the MPS loaded with only the antigen group indicates ova-specific CD4+ TH cell proliferation.
[0027] FIGS. 12 A-B are histograms showing that antibody titer is defined as the degree to which the antibody-serum solution can be diluted and still contain a detectable amount of the antibody. The anti-ovalbumin serum antibodies were titrated. The MPS scaffold loaded with GM-CSF, CpG-ODN and ova elicited a strong and durable TH1 and TH2 antibody response. MPS loaded with OVA alone can elicit a strong TH2 response, indicating the adjuvant potential of the MPS material itself.
[0028] FIGS. 13 A-B are line graphs showing that GM-CSF is released from the MPS microparticles in a controlled and sustained manner. A) 1 μg of GM-CSF was loaded into 5 mg of MPS rods and incubated in 0.1% BSA/PBS. Supernatant was collected periodically and measured for GM-CSF using ELISA (R&D). GM-CSF was continuously released from the MPS rods, although in small quantities. B) 1 μg of GM-CSF was loaded into 5 mg of MPS containing OVA and CpG. It was then injected subcutaneously into C57BL/6j mice. At various time points, the tissue surrounding the injected particle scaffold was harvested and analyzed for GM-CSF level. The level of GM-CSF was maintained throughout a week.
[0029] FIGS. 14 A-B are photographs, and FIG. 14C is a bar graph. Higher aspect ratio MPS microparticles recruit more cells. FIG. 14A shows SEM images of MPS microparticles either between 10 μm and 20 μm or between 80 μm and 120 μm in length. The longer rods resulted in a composition with greater area or space between the rods. FIG. 14B shows MPS compositions that was harvested from mice. 5 μg of MPS microparticles were injected subcutaneously into mice, and the scaffold site was harvested on day 7 post injection. FIG. 14 C is a bar graph showing enumeration of cells that were isolated from the scaffold. MPS microparticles of higher aspect ratio recruited more cells.
[0030] FIGS. 15 A-B are bar graphs. Dendritic cells (DCs) are recruited to the MPS microparticle as a response to GM-CSF. MPS microparticles were loaded with GM-CSF (0 ng, 500 ng, 1000 ng, 3000 ng) and injected subcutaneously into mice. On day 7 post injection, the scaffold was harvested and analyzed using flow cytometry. FIG. 15A shows that recruited CD11c+ CD11b+ DCs increases with increasing GM-CSF dose. FIG. 15B shows that recruited mature CD11c+ MHCII+ DCs also DCs increases with increasing GM-CSF dose.
[0031] FIG. 16 is a bar graph showing that GM-CSF increases recruited DC trafficking to the draining LN. MPS microparticles were loaded with Alexa 647 labeled ovalbumin (OVA), or Alexa 647 labeled OVA with 1 μg GM-CSF, and injected subcutaneously into mice. On day 7 post injection, the draining lymph node (dLN) was harvested and analyzed using flow cytometry. With the addition of antigen (OVA), there is a modest increase of Alexa 647+ CD11c+ DCs that have trafficked to the scaffold and up-taken the OVA. However, the addition of GM-CSF drastically increases DC trafficking from the scaffold to the dLN.
[0032] FIGS. 17 A-C are scatterplots and FIG. 17D is a bar graph. Local delivery of CpG-ODN from the MPS microparticle scaffold increases circulation of activated DCs. MPS microparticles were loaded with 1 μg of GM-CSF, 300 μg of OVA and 100 μg of CpG-ODN. They were then injected subcutaneously into mice. The dLNs were harvested and analyzed after 7 days post injection. LN cells were stained with CD11c and CD86. The addition of CpG-ODN, which is locally released from the MPS scaffold, further increases the percentage and number of activated, mature DCs in the dLN.
[0033] FIGS. 18 A-C are photographs and FIG. 18 D is a bar graph. Proteins are released from the MPS microparticle scaffold in a controlled and sustained manner. Alexa 647 labeled ovalbumin was injected subcutaneously into the flank of a mouse either in a buffer solution or loaded onto the MPS microparticles. Relative fluorescence was measured using the IVIS at various time points. If injected in a buffer solution, the protein diffuses away from the injection site in less than 1 day. However, if loaded onto the MPS microparticles, the protein is released from the local scaffold site in a sustained manner, e.g., over the course of a week (2, 3, 4, 5, 7 or more days).
[0034] FIGS. 19 A-B are line graphs showing antibody titers. Antibody titer is defined as the degree to which the antibody-serum solution can be diluted and still contain a detectable amount of the antibody. Mice were vaccinated with 300 μg OVA, 100 μg CpG-ODN and 1 μg GM-CSF in the soluble form or loaded in 5 mg of MPS microparticles. The anti-ovalbumin serum antibodies are titrated. The MPS scaffold loaded with GM-CSF, CpG-ODN and ova can elicit a strong and durable TH1 and TH2 antibody response, as indicated by a high titer of the IgG2a and IgG1 antibody, respectively. More impressively, this response is evident beyond 200 days after vaccination with a single injection. This response was compared to OVA delivered using aluminum hydroxide, the only adjuvant approved for human use in the US. While the MPS vaccine is capable of inducing both TH1 and TH2 antibody responses, due to its capability to load small cytokines, proteins and DNAs, the response induced by alum is completely TH2 biased. The MPS vaccine is very versatile and is readily fine tuned and controlled to induce specific immune responses.
[0035] FIGS. 20 A-D are scatterplots showing that vaccination with the MPS vaccine induces the expansion of T follicular helper cells. OT-II splenocytes were stained with CFSE and adoptively transferred into Thy1.1+ recipient mice. The recipient mice were then vaccinated with MPS and lysozyme, MPS and OVA, and the full form of the vaccine containing GM-CSF and CpG. Three days after vaccination, dLN were harvested and the adoptively transferred cells were analyzed. It is shown here that mice that were vaccinated with MPS and ova, and the full form of the vaccine, generated a strong population of follicular T helper cells, which are the cells directly responsible for “helping” B cells to differentiate and mature into full, functional antigen specific antibody secreting plasma cells.
[0036] FIGS. 21 A-D are line graphs showing that vaccination with the MPS vaccine induces the clonal expansion of CD4+ T helper cells. OT-II splenocytes were stained with CFSE and adoptively transferred into Thy1.1+ recipient mice. The recipient mice were then vaccinated with MPS and lysozyme, MPS and OVA, and the full form of the vaccine containing GM-CSF and CpG. Three days after vaccination, dLN were harvested and the adoptively transferred cells were analyzed. It is shown here that both MPS and OVA, and the full vaccine, induced strong clonal expansion of the CD4+ T helper cells, indicating a systemic antigen specific response.
[0037] FIG. 22 A-B are line graphs showing that glycolic acid and lactic acid modification of the MPS microparticles aids the release of bioactive GM-CSF. 1 μg of GM-CSF was loaded into 5 mg of glycolic acid or lactic acid modified MPS rods and incubated in 0.1% BSA/PBS. Supernatant was collected periodically and measured for GM-CSF using ELISA (R&D). Compared to GM-CSF released from unmodified MPS microparticles, glycolic acid and lactic acid modification increasecumulative release of bioactive GM-CSF by more than 20 fold.
[0038] FIGS. 23 A-D are scatterplots showing that glycolic acid modified MPS increases the percentage of recruited DCs and mature DCs. 5 mg of unmodified or glycolic acid modified MPS microparticles were loaded with 1 μg of GM-CSF for 1 hour at 37 C, and injected subcutaneously into mice. The scaffold was harvested at day 7 and analyzed. It is evident here that the modified MPS almost doubles the percentage of recruited CD11c+ CD11b+ DCs, and more drastically increases the percentage of CD11c+ CD86+ mature DCs. These results indicate that the great surface modification potential of the MPS microparticles permit further manipulation of the phenotype of recruited cells to induce more potent immune responses.
Detailed Description
[0039] Injectable MPS-based micro-rods randomly self-assemble to form 3D scaffold in vivo. This system is designed such that it releases a cytokine to recruit and transiently house immune cells, present them with an antigen, and activate them with a danger signal. After recruitment and temporary housing or presence of the cells in the structure, these immune cells migrate out of the device structure and homed to a lymph node. Thus, the composition is one in which cells traffic/circulate in and out of, their status of immune activation being altered/modulated as a result of the trafficking through the device.
[0040] A markedly expanded population of antigen specific dendritic cells was found in the lymph node as well as the formation of the germinal center, which is aided by the involvement of follicular T helper cells in the lymph node as a result of the administration of the device. A population of antigen-recognizing CD8+ CTLs in the spleen was also found to be significantly enhanced. The system also induces the clonal expansion of both antigen specific CD4 and CD8 T cells. In addition to the significant amplification of the cellular immune response, a high and durable antibody production and a balanced TH1/TH2 response was detected.
[0041] Key elements of the injectable mesoporous silica micro-rod based scaffold system for modulating immune cell trafficking and reprogramming include:
[0042] Aspect ratio of the MPS micro rods (10 nm cross sectional area by 100 micron length) prevents their uptake and therefore allows for local formation of a 3D structure.
[0043] 8 nm pore size allows for adsorption of small molecules that can be delivered via diffusion in a controlled and continuous manner.
[0044] High surface area to volume ratio allows for the control of the loading of various cytokines, danger signal and antigen.
[0045] Inflammatory property of the MPS micro rods promotes immune cell recruitment without the need of other inflammatory cytokines.
[0046] Versatility in ability of surface chemical modification of the MPS rods that modulate properties of the rods and ways that proteins are bound to the rods.
[0047] Controlled release of GM-CSF can modulate the trafficking of immune cells to the site of the scaffold.
[0048] Controlled release of CpG-ODN activates the recruited dendritic cells.
[0049] Anchored protein antigens are taken up by the recruited immune cells at the site of the scaffold.
[0050] A pore size of approximately 5-10, e.g., 8 nm, was found to be optimal for loading efficiency for small molecules as well as larger proteins, e.g., GM-CSF (which molecule is about 3 nm in diameter).
[0051] Upon subcutaneous injection of the micro rods suspended in a buffer, the rods randomly stack into a 3D structure; the ends of the rods form physical contact with each other, and a micro space is formed between the contacts.
MPS
[0052] Mesoporous silica nanoparticles are synthesized by reacting tetraethyl orthosilicate with a template made of micellar rods. The result is a collection of nano-sized spheres or rods that are filled with a regular arrangement of pores. The template can then be removed by washing with a solvent adjusted to the proper pH. In another technique, the mesoporous particle could be synthesized using a simple sol-gel method or a spray drying method. Tetraethyl orthosilicate is also used with an additional polymer monomer (as a template). Other methods include those described in U.S. Patent Publication 20120264599 and 20120256336, hereby incorporated by reference.
Granulocyte Macrophage Colony Stimulating Factor (GM-CSF)
[0053] Granulocyte-macrophage colony-stimulating factor (GM-CSF) is a protein secreted by macrophages, T cells, mast cells, endothelial cells and fibroblasts. Specifically, GM-CSF is a cytokine that functions as a white blood cell growth factor. GM-CSF stimulates stem cells to produce granulocytes and monocytes. Monocytes exit the blood stream, migrate into tissue, and subsequently mature into macrophages.
[0054] Scaffold devices described herein comprise and release GM-CSF polypeptides to attract host DCs to the device. Contemplated GM-CSF polypeptides are isolated from endogenous sources or synthesized in vivo or in vitro. Endogenous GM-CSF polypeptides are isolated from healthy human tissue. Synthetic GM-CSF polypeptides are synthesized in vivo following transfection or transformation of template DNA into a host organism or cell, e.g. a mammal or cultured human cell line. Alternatively, synthetic GM-CSF polypeptides are synthesized in vitro by polymerase chain reaction (PCR) or other art-recognized methods Sambrook, J., Fritsch, E. F., and Maniatis, T., Molecular Cloning: A Laboratory Manual. Cold Spring Harbor Laboratory Press, NY, Vol. 1, 2, 3 (1989), herein incorporated by reference).
[0055] GM-CSF polypeptides are modified to increase protein stability in vivo. Alternatively, GM-CSF polypeptides are engineered to be more or less immunogenic. Endogenous mature human GM-CSF polypeptides are glycosylated, reportedly, at amino acid residues 23 (leucine), 27 (asparagine), and 39 (glutamic acid) (see U.S. Pat. No. 5,073,627). GM-CSF polypeptides of the present invention are modified at one or more of these amino acid residues with respect to glycosylation state.
[0056] GM-CSF polypeptides are recombinant. Alternatively GM-CSF polypeptides are humanized derivatives of mammalian GM-CSF polypeptides. Exemplary mammalian species from which GM-CSF polypeptides are derived include, but are not limited to, mouse, rat, hamster, guinea pig, ferret, cat, dog, monkey, or primate. In a preferred embodiment, GM-CSF is a recombinant human protein (PeproTech, Catalog #300-03). Alternatively, GM-CSF is a recombinant murine (mouse) protein (PeproTech, Catalog #315-03). Finally, GM-CSF is a humanized derivative of a recombinant mouse protein.
[0057] Human Recombinant GM-CSF (PeproTech, Catalog #300-03) is encoded by the following polypeptide sequence (SEQ ID NO:2):
[0058]
| MAPARSPSPS TQPWEHVNAI QEARRLLNLS RDTAAEMNET | |
| VEVISEMFDL QEPTCLQTRL ELYKQGLRGS LTKLKGPLTM | |
| MASHYKQHCP PTPETSCATQ IITFESFKEN LKDFLLVIPF | |
| DCWEPVQE |
[0059] Murine Recombinant GM-CSF (PeproTech, Catalog #315-03) is encoded by the following polypeptide sequence (SEQ ID NO: 3):
[0060]
| MAPTRSPITV TRPWKHVEAI KEALNLLDDM PVTLNEEVEV | |
| VSNEFSFKKL TCVQTRLKIF EQGLRGNFTK LKGALNMTAS | |
| YYQTYCPPTP ETDCETQVTT YADFIDSLKT FLTDIPFECK | |
| KPVQK |
[0061] Human Endogenous GM-CSF is encoded by the following mRNA sequence (NCBI Accession No. NM_000758 and SEQ ID NO: 4):
[0062]
| 1 | acacagagag aaaggctaaa gttctctgga ggatgtggct |
| gcagagcctg ctgctcttgg | |
| 61 | gcactgtggc ctgcagcatc tctgcacccg cccgctcgcc |
| cagccccagc acgcagccct | |
| 121 | gggagcatgt gaatgccatc caggaggccc ggcgtctcct |
| gaacctgagt agagacactg | |
| 181 | ctgctgagat gaatgaaaca gtagaagtca tctcagaaat |
| gtttgacctc caggagccga | |
| 241 | cctgcctaca gacccgcctg gagctgtaca agcagggcct |
| gcggggcagc ctcaccaagc | |
| 301 | tcaagggccc cttgaccatg atggccagcc actacaagca |
| gcactgccct ccaaccccgg | |
| 361 | aaacttcctg tgcaacccag attatcacct ttgaaagttt |
| caaagagaac ctgaaggact | |
| 421 | ttctgcttgt catccccttt gactgctggg agccagtcca |
| ggagtgagac cggccagatg | |
| 481 | aggctggcca agccggggag ctgctctctc atgaaacaag |
| agctagaaac tcaggatggt | |
| 541 | catcttggag ggaccaaggg gtgggccaca gccatggtgg |
| gagtggcctg gacctgccct | |
| 601 | gggccacact gaccctgata caggcatggc agaagaatgg |
| gaatatttta tactgacaga | |
| 661 | aatcagtaat atttatatat ttatattttt aaaatattta |
| tttatttatt tatttaagtt | |
| 721 | catattccat atttattcaa gatgttttac cgtaataatt |
| attattaaaa atatgcttct | |
| 781 | a |
[0063] Human Endogenous GM-CSF is encoded by the following amino acid sequence (NCBI Accession No. NP_000749.2 and SEQ ID NO: 5):
[0064]
Cytosine-Guanosine (CpG) Oligonucleotide (CpG-ODN) Sequences
| MWLQSLLLLGTVACSISAPARSPSPSTQPWEHVNAIQEARRLLNLSRDT |
| AAEMNETVEVISEMFDLQEPTCLQTRLELYKQGLRGSLTKLKGPLTMM |
| ASHYKQHCPPTPETSCATQIITFESFKENLKDFLLVIPFDCWEPVQE |
Cytosine-Guanosine (CpG) Oligonucleotide (CpG-ODN) Sequences
[0065] CpG sites are regions of deoxyribonucleic acid (DNA) where a cysteine nucleotide occurs next to a guanine nucleotide in the linear sequence of bases along its length (the “p” represents the phosphate linkage between them and distinguishes them from a cytosine-guanine complementary base pairing). CpG sites play a pivotal role in DNA methylation, which is one of several endogenous mechanisms cells use to silence gene expression. Methylation of CpG sites within promoter elements can lead to gene silencing. In the case of cancer, it is known that tumor suppressor genes are often silenced while oncogenes, or cancer-inducing genes, are expressed. CpG sites in the promoter regions of tumor suppressor genes (which prevent cancer formation) have been shown to be methylated while CpG sites in the promoter regions of oncogenes are hypomethylated or unmethylated in certain cancers. The TLR-9 receptor binds unmethylated CpG sites in DNA.
[0066] The vaccine composition described herein comprises CpG oligonucleotides. CpG oligonucleotides are isolated from endogenous sources or synthesized in vivo or in vitro. Exemplary sources of endogenous CpG oligonucleotides include, but are not limited to, microorganisms, bacteria, fungi, protozoa, viruses, molds, or parasites. Alternatively, endogenous CpG oligonucleotides are isolated from mammalian benign or malignant neoplastic tumors. Synthetic CpG oligonucleotides are synthesized in vivo following transfection or transformation of template DNA into a host organism. Alternatively, Synthetic CpG oligonucleotides are synthesized in vitro by polymerase chain reaction (PCR) or other art-recognized methods (Sambrook, J., Fritsch, E. F., and Maniatis, T., Molecular Cloning: A Laboratory Manual. Cold Spring Harbor Laboratory Press, NY, Vol. 1, 2, 3 (1989), herein incorporated by reference).
[0067] CpG oligonucleotides are presented for cellular uptake by dendritic cells. For example, naked CpG oligonucleotides are used. The term “naked” is used to describe an isolated endogenous or synthetic polynucleotide (or oligonucleotide) that is free of additional substituents. In another embodiment, CpG oligonucleotides are bound to one or more compounds to increase the efficiency of cellular uptake. Alternatively, or in addition, CpG oligonucleotides are bound to one or more compounds to increase the stability of the oligonucleotide within the scaffold and/or dendritic cell. CpG oligonucleotides are optionally condensed prior to cellular uptake. For example, CpG oligonucleotides are condensed using polyethylimine (PEI), a cationic polymer that increases the efficiency of cellular uptake into dendritic cells.
[0068] CpG oligonucleotides can be divided into multiple classes. For example, exemplary CpG-ODNs encompassed by compositions, methods and devices of the present invention are stimulatory, neutral, or suppressive. The term “stimulatory” describes a class of CpG-ODN sequences that activate TLR9. The term “neutral” describes a class of CpG-ODN sequences that do not activate TLR9. The term “suppressive” describes a class of CpG-ODN sequences that inhibit TLR9. The term “activate TLR9” describes a process by which TLR9 initiates intracellular signaling.
[0069] Stimulatory CpG-ODNs can further be divided into three types A, B and C, which differ in their immune-stimulatory activities. Type A stimulatory CpG ODNs are characterized by a phosphodiester central CpG-containing palindromic motif and a phosphorothioate 3′ poly-G string. Following activation of TLR9, these CpG ODNs induce high IFN-α production from plasmacytoid dendritic cells (pDC). Type A CpG ODNs weakly stimulate TLR9-dependent NF-κB signaling.
[0070] Type B stimulatory CpG ODNs contain a full phosphorothioate backbone with one or more CpG dinucleotides. Following TLR9 activation, these CpG-ODNs strongly activate B cells. In contrast to Type A CpG-ODNs, Type B CpG-ODNS weakly stimulate IFN-α secretion.
[0071] Type C stimulatory CpG ODNs comprise features of Types A and B. Type C CpG-ODNs contain a complete phosphorothioate backbone and a CpG containing palindromic motif. Similar to Type A CpG ODNs, Type C CpG ODNs induce strong IFN-α production from pDC. Similar to Type B CpG ODNs, Type C CpG ODNs induce strong B cell stimulation.
[0072] Exemplary stimulatory CpG ODNs comprise, but are not limited to, ODN 1585, ODN 1668, ODN 1826, ODN 2006, ODN 2006-G5, ODN 2216, ODN 2336, ODN 2395, ODN M362 (all InvivoGen). The present invention also encompasses any humanized version of the preceding CpG ODNs. In one preferred embodiment, compositions, methods, and devices of the present invention comprise ODN 1826 (the sequence of which from 5′ to 3′ is tccatgacgttcctgacgtt, wherein CpG elements are bolded, SEQ ID NO: 10).
[0073] Neutral, or control, CpG ODNs that do not stimulate TLR9 are encompassed by the present invention. These ODNs comprise the same sequence as their stimulatory counterparts but contain GpC dinucleotides in place of CpG dinucleotides.
[0074] Exemplary neutral, or control, CpG ODNs encompassed by the present invention comprise, but are not limited to, ODN 1585 control, ODN 1668 control, ODN 1826 control, ODN 2006 control, ODN 2216 control, ODN 2336 control, ODN 2395 control, ODN M362 control (all InvivoGen). The present invention also encompasses any humanized version of the preceding CpG ODNs.
Antigens
[0075] Compositions, methods, and devices described herein comprise tumor antigens or other antigens. Antigens elicit protective immunity or generate a therapeutic immune response in a subject to whom such a device was administered. Preferred tumor antigens are tumor cell lysates (see, e.g., Ali et. Al., 2009, Nature Materials 8, 151-158; hereby incorporated by reference). For example, a whole tumor or tumor biopsy sample is extracted from a human patient (or non-human animal), and digested using collagenase to degrade the extra cellular matrix. Then the tumor cells then undergo three cycles of the freeze thaw process, in which the cells are frozen in liquid N2 and then thawed in a water bath. This process generates the tumor antigens, which are then loaded onto the MPS particles at the same time with GM-CSF and CpG ODN. For example, a vaccine dose of tumor cell lysate antigen is the amount obtained from 1×106 tumor cells. After fabrication of the MPS particles, the particles are suspended in a physiologically accepted buffer, e.g., PBS, and the recruitment compound (e.g., GM-CSF), activating compound (e.g., CpG), and antigen added to the suspension of rods. The mixture is shaken at room temperature overnight and then lyophilized for about 4 hours. Prior to administration, the rods are again suspended in buffer and the suspension loaded into a 1 ml syringe (18 gauge needle). A typical vaccine dose is 150 μl of the mixture per injection.
[0076] Exemplary cancer antigens encompassed by the compositions, methods, and devices of the present invention include, but are not limited to, tumor lysates extracted from biopsies, irradiated tumor cells, MAGE series of antigens (MAGE-1 is an example), MART-1/melana, tyrosinase, ganglioside, gp100, GD-2, O-acetylated GD-3, GM-2, MUC-1, Sos1, Protein kinase C-binding protein, Reverse transcriptase protein, AKAP protein, VRK1, KIAA1735, T7-1, T11-3, T11-9, Homo Sapiens telomerase ferment (hTRT), Cytokeratin-19 (CYFRA21-1), SQUAMOUS CELL CARCINOMA ANTIGEN 1 (SCCA-1), (PROTEIN T4-A), SQUAMOUS CELL CARCINOMA ANTIGEN 2 (SCCA-2), Ovarian carcinoma antigen CA125 (1A1-3B) (KIAA0049), MUCIN 1 (TUMOR-ASSOCIATED MUCIN), (CARCINOMA-ASSOCIATED MUCIN), (POLYMORPHIC EPITHELIAL MUCIN), (PEM), (PEMT), (EPISIALIN), (TUMOR-ASSOCIATED EPITHELIAL MEMBRANE ANTIGEN), (EMA), (H23AG), (PEANUT-REACTIVE URINARY MUCIN), (PUM), (BREAST CARCINOMA-ASSOCIATED ANTIGEN DF3), CTCL tumor antigen se1-1, CTCL tumor antigen se14-3, CTCL tumor antigen se20-4, CTCL tumor antigen se20-9, CTCL tumor antigen se33-1, CTCL tumor antigen se37-2, CTCL tumor antigen se57-1, CTCL tumor antigen se89-1, Prostate-specific membrane antigen, 5T4 oncofetal trophoblast glycoprotein, Orf73 Kaposi's sarcoma-associated herpesvirus, MAGE-C1 (cancer/testis antigen CT7), MAGE-B1 ANTIGEN (MAGE-XP ANTIGEN) (DAM10), MAGE-B2 ANTIGEN (DAM6), MAGE-2 ANTIGEN, MAGE-4a antigen, MAGE-4b antigen, Colon cancer antigen NY-CO-45, Lung cancer antigen NY-LU-12 variant A, Cancer associated surface antigen, Adenocarcinoma antigen ART1, Paraneoplastic associated brain-testis-cancer antigen (onconeuronal antigen MA2; paraneoplastic neuronal antigen), Neuro-oncological ventral antigen 2 (NOVA2), Hepatocellular carcinoma antigen gene 520, TUMOR-ASSOCIATED ANTIGEN CO-029, Tumor-associated antigen MAGE-X2, Synovial sarcoma, X breakpoint 2, Squamous cell carcinoma antigen recognized by T cell, Serologically defined colon cancer antigen 1, Serologically defined breast cancer antigen NY-BR-15, Serologically defined breast cancer antigen NY-BR-16, Chromogranin A; parathyroid secretory protein 1, DUPAN-2, CA 19-9, CA 72-4, CA 195, Carcinoembryonic antigen (CEA). Purified tumor antigens are used alone or in combination with one another.
[0077] The system is also useful to generate an immune response to other antigens such as microbial pathogens (e.g., bacteria, viruses, fungi).
[0078] The following materials and methods were used to generate the data described herein.
MPS Scaffold Fabrication
[0079] The Pluronic P-123 (Sigma-Aldrich) surfactant was dissolved in 1.6M HCl at room temperature, and heated 40 degrees C. 42 mmol of Tetraethyl orthosilicate (TEOS) (Sigma-Aldrich) was added and heated for 20 hours at 40 degrees C. under stirring (600 rpm). The composition was then heated to 100 degrees C. for 24 hours. The rod particles were collected by filtration and air dried at room temperature. The particles were extracted in ethanol/HCl (5 parts HCl to 500 parts EtOH) overnight at 80 degrees C. Alternatively, the particles were calcined at 550 degrees C. for 4 hours in 100% ethanol. The MPS composition may be stored and shipped for use before or after adding recruitment and/or activation compounds and before or after adding antigen. For example, if antigen is a tumor cells lysate made from a biopsy sample taken from a patient, it may be processed and added to MPS particles shortly before administration to the patient.
[0080] For full vaccine composition, 1 μg/mouse GM-CSF, 100 μg/mouse CpG-ODN and 130 μg/mouse of the ovalbumin protein were incubated with 5 mg/mouse MPS in dH2O for 12 hours, lyophilized for 12 hours, resuspended in 150 μl/mouse PBS and injected subcutaneously using a 18G needle.
[0081] To determine the release kinetics of GM-CSF, and CpG-ODN from the MPS rods, radioactive I-labeled recombinant human GM-CSF was used as a tracer, and standard release studies were carried out. Similarly, the amount of CpG-ODN released into PBS was determined by the absorbance readings using a Nanodrop instrument (ND1000, Nanodrop Technologies).
Modification of MPS Microparticles
[0082] Standard 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide (EDC) chemistry is used to activate a carboxylic acid on glycolic acid or lactic acid. The MPS particles are amine modified using amine propyl silane. The two components are then mixed together at room temperature overnight to react. The particles are then allowed to air dry. The resulting glycolic acid and/or lactic acid modified particles are then contacted with GM-CSF or other compounds as described above.
In Vitro DC Activation Assay
[0083] Murine Dendritic Cells (DCs) were differentiated from the bone marrow cells using 20 ng/ml GM-CSF. Differentiated DCs, at 106/ml, were incubated with 100 μg/ml of the MPS particles for 18 hours, and analyzed for the expression of CD11c (ebiosciences, San Diego, Calif.), CD86 (ebiosciences, San Diego, Calif.) and MHC class-II (ebiosciences, San Diego, Calif.) using flow cytometry.
Analysis of DC Recruitment to MPS Scaffold and Emigration to Lymph Nodes
[0084] The MPS scaffold was retrieved from the animal and digested by mechanically separating the cells from the rods. APC conjugated CD11c (dendritic cell marker), FITC conjugated MHC class-II, and PE conjugated CD86 (B7, costimulatory molecule) stains were used for DC and leukocyte recruitment analysis. Cells were gated according to positive fluorescein isothiocyanate (FITC), Allophycocyanin (APC) and phycoerythrin (PE) using isotype controls, and the percentage of cells staining positive for each surface antigen was recorded.
[0085] To determine the presence of antigen specific DCs in the lymph nodes, the draining lymph node (dLN) was harvested and analyzed using APC conjugated CD11c and PE conjugated SIINFEKL-MHC class-I (ebiosciences, San Diego, Calif.).
Analysis of Antigen Specific CD8+ Spleen T Cells
[0086] The spleen was harvested and digested. After lysing the red blood cells, the splenocytes were analyzed using PE-CY7 conjugated CD3 (ebiosciences, San Diego, Calif.), APC conjugated CD8 (ebiosciences, San Diego, Calif.) and the PE conjugated SIINFEKL (SEQ ID NO:) MHC class-I tetramer (Beckman Coulter). SIINFEKL is an ovalbumin derived peptide [OVA(257-264)].
Analysis of CD4+ or CD8+ T Cell Clonal Expansion
[0087] The spleens from the OT-II (for CD4) or OT-I (for CD8) transgenic C57bl/6 mice (Jackson Laboratories) were harvested, digested, pooled and stained with the cell tracer Carboxyfluorescein succinimidyl ester (CFSE). 20×106 stained splenocytes/mouse were IV injected into the C57bl/6 (Jackson Laboratories) mice two days post immunization. The dLNs and spleens were retrieved after four days post IV injection and analyzed using PE conjugated CD8 or CD4 marker.
Characterization of Anti-OVA Humoral Response
[0088] Blood sera were analyzed for IgG1, and IgG2a antibodies by ELISA using ovalbumin-coated plates. Antibody titration was defined as the lowest serum dilution at which the ELISA OD reading is >0.3 (blank).
Other Embodiments
[0089] While the invention has been described in conjunction with the detailed description thereof, the foregoing description is intended to illustrate and not limit the scope of the invention, which is defined by the scope of the appended claims. Other aspects, advantages, and modifications are within the scope of the following claims.
[0090] The patent and scientific literature referred to herein establishes the knowledge that is available to those with skill in the art. All United States patents and published or unpublished United States patent applications cited herein are incorporated by reference. All published foreign patents and patent applications cited herein are hereby incorporated by reference. Genbank and NCBI submissions indicated by accession number cited herein are hereby incorporated by reference. All other published references, documents, manuscripts and scientific literature cited herein are hereby incorporated by reference.
[0091] While this invention has been particularly shown and described with references to preferred embodiments thereof, it will be understood by those skilled in the art that various changes in form and details may be made therein without departing from the scope of the invention encompassed by the appended claims.
Claims
The invention claimed is:
1. A composition comprising mesoporous silica rods comprising
an immune cell recruitment compound comprising granulocyte macrophage-colony stimulating factor (GM-CSF), chemokine (C-C motif) ligand 21 (CCL-21), chemokine (C-C motif) ligand 19 (CCl-19), or a FMS-like tyrosine kinase 3 (Flt-3) ligand; and
an immune cell activation compound comprising a TLR agonist,
wherein said rods comprise a length of 25 μm to 500 μm and pores of between 2 nm to 50 nm in diameter, and
wherein said rods are stacked into a 3D structure, wherein said structure comprises micro spaces that allow for immune cell infiltration or trafficking.
2. An injectable composition comprising mesoporous silica rods comprising
an immune cell recruitment compound comprising granulocyte macrophage-colony stimulating factor (GM-CSF), chemokine (C-C motif) ligand 21 (CCL-21), chemokine (C-C motif) ligand 19 (CCl-19), or a FMS-like tyrosine kinase 3 (Flt-3) ligand; and
an immune cell activation compound comprising a TLR agonist,
wherein said rods comprise a length of 25 μm to 500 μm and pores of between 2 nm to 50 nm in diameter, and
wherein said rods self-assemble into a 3D structure in vivo, and wherein said structure comprises micro spaces that allow for immune cell infiltration or trafficking.
3. The composition of claim 1, wherein said TLR agonist comprises a pathogen associated molecular pattern (PAMP).
4. The composition of claim 3, wherein said PAMP comprises a bacterially-derived immunomodulator.
5. The composition of claim 1, wherein said TLR agonist comprises a nucleic acid, a lipid, double stranded deoxyribonucleic acid (DNA), double stranded ribonucleic acid (RNA), or a lipopolysaccharide.
6. The composition of claim 1, wherein said TLR agonist comprises a TLR3 agonist or a TLR9 agonist.
7. The composition of claim 1, wherein said rods comprise pores of between 2-50 nm in diameter.
8. The composition of claim 1, wherein said rods comprise pores of between 5-25 nm in diameter.
9. The composition of claim 1, wherein said rods comprise pores of between 5-10 nm in diameter.
10. The composition of claim 1, wherein said rods comprise pores of approximately 8 nm in diameter.
11. The composition of claim 1, wherein said rods comprise a length of 25 μm to 250 μm.
12. The composition of claim 1, wherein said rods comprise a length of 80 μm to 120 μm.
13. The composition of claim 1, wherein said recruitment compound comprises GM-CSF.
14. The composition of claim 1, wherein said composition further comprises an antigen.
15. The composition of claim 14, wherein said antigen comprises a tumor antigen.
16. The composition of claim 15, wherein said tumor antigen is present in a tumor cell lysate.
17. The composition of claim 14, wherein said antigen comprises MAGE-1, MART-1/melana, tyrosinase, ganglioside, gp100, GD-2, O-acetylated GD-3, GM-2, Mucin 1, Sos1, protein kinase C-binding protein, reverse transcriptase protein, AKAP protein, VRK1, KIAA1735, T7-1, T11-3, T11-9, Homo sapiens telomerase ferment (hTRT), Cytokeratin-19 (CYFRA21-1), squamous cell carcinoma antigen 1 (SCCA-1), Protein T4-A, squamous cell carcinoma antigen 2 (SCCA-2), ovarian carcinoma antigen CA125 (1A1-3B) (KIAA0049), CTCL tumor antigen se1-1, CTCL tumor antigen se14-3, CTCL tumor antigen se20-4, CTCL tumor antigen se20-9, CTCL tumor antigen se33-1, CTCL tumor antigen se37-2, CTCL tumor antigen se57-1, CTCL tumor antigen se89-1, prostate specific membrane antigen, 5T4 oncofetal trophoblast glycoprotein, Orf73 Kaposi's sarcoma-associated herpesvirus, MAGE-C1 (cancer/testis antigen CT7), MAGE-B1 Antigen (MAGE-XP Antigen), DAM10, MAGE-B2 Antigen (DAM6), MAGE-2 Antigen, MAGE-4a antigen, MAGE-4b antigen, colon cancer antigen NY-CO-45, lung cancer antigen NY-LU-12 variant A, cancer associated surface antigen, adenocarcinoma antigen ART1, paraneoplastic associated brain-testis-cancer antigen, onconeuronal antigen MA2, paraneoplastic neuronal antigen, neuro oncological ventral antigen 2 (NOVA2), hepatocellular carcinoma antigen gene 520, tumor-associated antigen CO-029, tumor-associated antigen MAGE-X2, synovial sarcoma, X breakpoint 2, squamous cell carcinoma antigen recognized by T cell, seriologically defined colon cancer antigen 1, seriologically defined breast cancer antigen NY-BR-15, seriologically defined breast cancer antigen NY-BR-16, Chromogranin A; parathyroid secretory protein 1, DUPAN-2, CA 19-9, CA 72-4, CA 195, or carcinoembryonic antigen (CEA).
18. The composition of claim 1, wherein said rods comprise a length of 30 μm to 100 μm.
19. The composition of claim 1, wherein said rods comprise a length of 50 μm to 250 μm.
20. The composition of claim 2, wherein said TLR agonist comprises a pathogen associated molecular pattern (PAMP).
21. The composition of claim 20, wherein said PAMP comprises a bacterially-derived immunomodulator.
22. The composition of claim 2, wherein said TLR agonist comprises a nucleic acid, a lipid, double stranded deoxyribonucleic acid (DNA), double stranded ribonucleic acid (RNA), or a lipopolysaccharide.
23. The composition of claim 2, wherein said TLR agonist comprises a TLR3 agonist or a TLR9 agonist.
24. The composition of claim 2, wherein said rods comprise pores of between 2-50 nm in diameter.
25. The composition of claim 2, wherein said rods comprise pores of between 5-25 nm in diameter.
26. The composition of claim 2, wherein said rods comprise pores of between 5-10 nm in diameter.
27. The composition of claim 2, wherein said rods comprise pores of approximately 8 nm in diameter.
28. The composition of claim 2, wherein said rods comprise a length of 25 μm to 250 μm.
29. The composition of claim 2, wherein said rods comprise a length of 80 μm to 120 μm.
30. The composition of claim 2, wherein said recruitment compound comprises GM-CSF.
31. The composition of claim 2, wherein said composition further comprises an antigen.
32. The composition of claim 31, wherein said antigen comprises a tumor antigen.
33. The composition of claim 32, wherein said tumor antigen is present in a tumor cell lysate.
34. The composition of claim 31, wherein said antigen comprises MAGE-1, MART-1/melana, tyrosinase, ganglioside, gp100, GD-2, O-acetylated GD-3, GM-2, Mucin 1, Sos1, protein kinase C-binding protein, reverse transcriptase protein, AKAP protein, VRK1, KIAA1735, T7-1, T11-3, T11-9, Homo sapiens telomerase ferment (hTRT), Cytokeratin-19 (CYFRA21-1), squamous cell carcinoma antigen 1 (SCCA-1), Protein T4-A, squamous cell carcinoma antigen 2 (SCCA-2), ovarian carcinoma antigen CA125 (1A1-3B) (KIAA0049), CTCL tumor antigen se1-1, CTCL tumor antigen se14-3, CTCL tumor antigen se20-4, CTCL tumor antigen se20-9, CTCL tumor antigen se33-1, CTCL tumor antigen se37-2, CTCL tumor antigen se57-1, CTCL tumor antigen se89-1, prostate specific membrane antigen, 5T4 oncofetal trophoblast glycoprotein, Orf73 Kaposi's sarcoma-associated herpesvirus, MAGE-C1 (cancer/testis antigen CT7), MAGE-B1 Antigen (MAGE-XP Antigen), DAM10, MAGE-B2 Antigen (DAM6), MAGE-2 Antigen, MAGE-4a antigen, MAGE-4b antigen, colon cancer antigen NY-CO-45, lung cancer antigen NY-LU-12 variant A, cancer associated surface antigen, adenocarcinoma antigen ART1, paraneoplastic associated brain-testis-cancer antigen, onconeuronal antigen MA2, paraneoplastic neuronal antigen, neuro oncological ventral antigen 2 (NOVA2), hepatocellular carcinoma antigen gene 520, tumor-associated antigen CO-029, tumor-associated antigen MAGE-X2, synovial sarcoma, X breakpoint 2, squamous cell carcinoma antigen recognized by T cell, seriologically defined colon cancer antigen 1, seriologically defined breast cancer antigen NY-BR-15, seriologically defined breast cancer antigen NY-BR-16, Chromogranin A; parathyroid secretory protein 1, DUPAN-2, CA 19-9, CA 72-4, CA 195, or carcinoembryonic antigen (CEA).
35. The composition of claim 2, wherein said rods comprise a length of 30 μm to 100 μm.
36. The composition of claim 2, wherein said rods comprise a length of 50 μm to 250 μm.
37. The composition of claim 1, wherein said rods comprise a diameter from 1.5 μm to 10 μm.
38. The composition of claim 2, wherein said rods comprise a diameter from 1.5 μm to 10 μm.
Patent Citations (211)
| Patent | Date | Inventor | Cited By |
|---|---|---|---|
| US3773919(A) | 1973-11-01 | Boswell et al. | Applicant |
| US4522811(A) | 1985-06-01 | Eppstein et al. | Applicant |
| US4946778(A) | 1990-08-01 | Ladner et al. | Applicant |
| US5073627(A) | 1991-12-01 | Curtis et al. | Applicant |
| US5091513(A) | 1992-02-01 | Huston et al. | Applicant |
| US5132405(A) | 1992-07-01 | Huston et al. | Applicant |
| US5885829(A) | 1999-03-01 | Mooney et al. | Applicant |
| US5888987(A) | 1999-03-01 | Haynes et al. | Applicant |
| US6129716(A) | 2000-10-01 | Steer | Applicant |
| US6193970(B1) | 2001-02-01 | Pardoll et al. | Applicant |
| US6251396(B1) | 2001-06-01 | Gaur et al. | Applicant |
| US6281256(B1) | 2001-08-01 | Harris et al. | Applicant |
| US6334968(B1) | 2002-01-01 | Shapiro et al. | Applicant |
| US6403374(B1) | 2002-06-01 | Tsien et al. | Applicant |
| US6429199(B1) | 2002-08-01 | Krieg et al. | Applicant |
| US6511650(B1) | 2003-01-01 | Eiselt et al. | Applicant |
| US6541022(B1) | 2003-04-01 | Murphy et al. | Applicant |
| US6642363(B1) | 2003-11-01 | Mooney et al. | Applicant |
| US6685963(B1) | 2004-02-01 | Taupin et al. | Applicant |
| US6748954(B2) | 2004-06-01 | Lee et al. | Applicant |
| US6767928(B1) | 2004-07-01 | Murphy et al. | Applicant |
| US6783712(B2) | 2004-08-01 | Slivka et al. | Applicant |
| US6790840(B1) | 2004-09-01 | Lee et al. | Applicant |
| US6797738(B2) | 2004-09-01 | Harris et al. | Applicant |
| US6800733(B2) | 2004-10-01 | Tsien et al. | Applicant |
| US7015205(B1) | 2006-03-01 | Wallack | Examiner |
| US7157566(B2) | 2007-01-01 | Tsien et al. | Applicant |
| US7186413(B2) | 2007-03-01 | Bouhadir et al. | Applicant |
| US7192693(B2) | 2007-03-01 | Bryant et al. | Applicant |
| US7427602(B1) | 2008-09-01 | Shea et al. | Applicant |
| US7575759(B2) | 2009-08-01 | Murphy et al. | Applicant |
| US7687241(B2) | 2010-03-01 | Chen | Applicant |
| US7790699(B2) | 2010-09-01 | Melvik et al. | Applicant |
| US8067237(B2) | 2011-11-01 | Mooney et al. | Applicant |
| US8188058(B2) | 2012-05-01 | Hackam et al. | Applicant |
| US8273373(B2) | 2012-09-01 | Alsberg et al. | Applicant |
| US8709464(B2) | 2014-04-01 | Ma et al. | Applicant |
| US8728456(B2) | 2014-05-01 | Sands et al. | Applicant |
| US8932583(B2) | 2015-01-01 | Mooney et al. | Applicant |
| US9012399(B2) | 2015-04-01 | Cao et al. | Applicant |
| US9132210(B2) | 2015-09-01 | Mooney et al. | Applicant |
| US9139809(B2) | 2015-09-01 | Porcelli | Examiner |
| US9370558(B2) | 2016-06-01 | Ali et al. | Applicant |
| US9446107(B2) | 2016-09-01 | Mooney et al. | Applicant |
| US9486512(B2) | 2016-11-01 | Kim et al. | Applicant |
| US2002/0131853(A1) | 2002-09-01 | Nagasawa | Applicant |
| US2002/0150604(A1) | 2002-10-01 | Yi et al. | Applicant |
| US2003/0075822(A1) | 2003-04-01 | Slivka et al. | Applicant |
| US2003/0082806(A1) | 2003-05-01 | Berenson et al. | Applicant |
| US2003/0095994(A1) | 2003-05-01 | Geistlich et al. | Applicant |
| US2003/0100527(A1) | 2003-05-01 | Krieg et al. | Applicant |
| US2003/0232895(A1) | 2003-12-01 | Omidian et al. | Applicant |
| US2004/0058883(A1) | 2004-03-01 | Phillips et al. | Applicant |
| US2004/0063206(A1) | 2004-04-01 | Rowley et al. | Applicant |
| US2004/0136968(A1) | 2004-07-01 | Zheng et al. | Applicant |
| US2004/0151764(A1) | 2004-08-01 | Zamora | Applicant |
| US2004/0220111(A1) | 2004-11-01 | Kleinman et al. | Applicant |
| US2004/0242469(A1) | 2004-12-01 | Lee et al. | Applicant |
| US2004/0242482(A1) | 2004-12-01 | Gehring et al. | Applicant |
| US2005/0002915(A1) | 2005-01-01 | Atala et al. | Applicant |
| US2005/0037330(A1) | 2005-02-01 | Fischer et al. | Applicant |
| US2005/0053667(A1) | 2005-03-01 | Irvine et al. | Applicant |
| US2005/0079159(A1) | 2005-04-01 | Shastri et al. | Applicant |
| US2005/0090008(A1) | 2005-04-01 | Segura et al. | Applicant |
| US2005/0106211(A1) | 2005-05-01 | Nelson et al. | Applicant |
| US2005/0154376(A1) | 2005-07-01 | Riviere et al. | Applicant |
| US2005/0177249(A1) | 2005-08-01 | Kladakis et al. | Applicant |
| US2005/0202394(A1) | 2005-09-01 | Dobson | Applicant |
| US2006/0083712(A1) | 2006-04-01 | Anversa | Applicant |
| US2006/0141018(A1) | 2006-06-01 | Cochrum et al. | Applicant |
| US2006/0264380(A1) | 2006-11-01 | Hellstrom et al. | Applicant |
| US2006/0292134(A1) | 2006-12-01 | Stohs | Applicant |
| US2007/0003595(A1) | 2007-01-01 | Wang et al. | Applicant |
| US2007/0020232(A1) | 2007-01-01 | Rossignol et al. | Applicant |
| US2007/0026518(A1) | 2007-02-01 | Healy et al. | Applicant |
| US2007/0081972(A1) | 2007-04-01 | Sandler et al. | Applicant |
| US2007/0116680(A1) | 2007-05-01 | Stegemann et al. | Applicant |
| US2007/0178159(A1) | 2007-08-01 | Chen et al. | Applicant |
| US2007/0190646(A1) | 2007-08-01 | Engler et al. | Applicant |
| US2008/0044900(A1) | 2008-02-01 | Mooney et al. | Applicant |
| US2008/0044990(A1) | 2008-02-01 | Lee | Applicant |
| US2008/0051490(A1) | 2008-02-01 | Williams et al. | Applicant |
| US2008/0138416(A1) | 2008-06-01 | Rauh et al. | Applicant |
| US2008/0152624(A1) | 2008-06-01 | Paludan et al. | Applicant |
| US2008/0206308(A1) | 2008-08-01 | Jabbari et al. | Applicant |
| US2008/0268052(A1) | 2008-10-01 | Voytik-Harbin et al. | Applicant |
| US2009/0017096(A1) | 2009-01-01 | Lowman et al. | Applicant |
| US2009/0192079(A1) | 2009-07-01 | Santos et al. | Applicant |
| US2009/0238853(A1) | 2009-09-01 | Liu et al. | Applicant |
| US2009/0297579(A1) | 2009-12-01 | Semino et al. | Applicant |
| US2009/0305983(A1) | 2009-12-01 | Ying et al. | Applicant |
| US2010/0015709(A1) | 2010-01-01 | Rehfeldt et al. | Applicant |
| US2010/0055186(A1) | 2010-03-01 | Dadsetan et al. | Applicant |
| US2010/0080816(A1) | 2010-04-01 | Hadeiba et al. | Applicant |
| US2010/0129422(A1) | 2010-05-01 | Han et al. | Applicant |
| US2010/0159008(A1) | 2010-06-01 | Barron et al. | Applicant |
| US2010/0189760(A1) | 2010-07-01 | Schaffer et al. | Applicant |
| US2010/0190741(A1) | 2010-07-01 | Cohen et al. | Applicant |
| US2010/0272771(A1) | 2010-10-01 | Harlow et al. | Applicant |
| US2011/0020216(A1) | 2011-01-01 | Mooney et al. | Applicant |
| US2011/0117170(A1) | 2011-05-01 | Cao et al. | Applicant |
| US2011/0300186(A1) | 2011-12-01 | Hellstrom | Examiner |
| US2012/0100182(A1) | 2012-04-01 | Mooney et al. | Applicant |
| US2012/0121539(A1) | 2012-05-01 | Sands et al. | Applicant |
| US2012/0122218(A1) | 2012-05-01 | Huebsch et al. | Applicant |
| US2012/0134967(A1) | 2012-05-01 | Mooney et al. | Applicant |
| US2012/0256336(A1) | 2012-10-01 | Yano et al. | Applicant |
| US2012/0264599(A1) | 2012-10-01 | Komatsu et al. | Applicant |
| US2012/0329791(A1) | 2012-12-01 | Ashwell et al. | Applicant |
| US2013/0029030(A1) | 2013-01-01 | Larsen | Applicant |
| US2013/0177536(A1) | 2013-07-01 | Mooney et al. | Applicant |
| US2013/0202707(A1) | 2013-08-01 | Ali et al. | Applicant |
| US2013/0302396(A1) | 2013-11-01 | Mooney et al. | Applicant |
| US2013/0331343(A1) | 2013-12-01 | Cao et al. | Applicant |
| US2014/0079752(A1) | 2014-03-01 | Huebsch et al. | Applicant |
| US2014/0112990(A1) | 2014-04-01 | Bencherif et al. | Applicant |
| US2014/0178964(A1) | 2014-06-01 | Mooney et al. | Applicant |
| US2014/0193488(A1) | 2014-07-01 | Kim et al. | Applicant |
| US2014/0227327(A1) | 2014-08-01 | Bencherif et al. | Applicant |
| US2014/0234423(A1) | 2014-08-01 | Sands et al. | Applicant |
| US2015/0024026(A1) | 2015-01-01 | Mooney et al. | Applicant |
| US2015/0366956(A1) | 2015-12-01 | Mooney et al. | Applicant |
| US2016/0220667(A1) | 2016-08-01 | Mooney et al. | Applicant |
| US2016/0220668(A1) | 2016-08-01 | Mooney et al. | Applicant |
| US2016/0228543(A1) | 2016-08-01 | Mooney et al. | Applicant |
| US2016/0271298(A1) | 2016-09-01 | Mooney et al. | Applicant |
| US2016/0279219(A1) | 2016-09-01 | Mooney et al. | Applicant |
| US2016/0279220(A1) | 2016-09-01 | Mooney et al. | Applicant |
| US2016/0296611(A1) | 2016-10-01 | Ali et al. | Applicant |
| US2017/0042995(A1) | 2017-02-01 | Ali et al. | Applicant |
| CN101655611(A) | 2010-02-01 | Applicant | |
| EP562862(A1) | 1993-09-01 | Applicant | |
| EP1452191(A2) | 2004-09-01 | Applicant | |
| EP1561481(A2) | 2005-08-01 | Applicant | |
| JP2003506401(A) | 2003-02-01 | Applicant | |
| JP2003180815(A) | 2003-07-01 | Applicant | |
| JP2004520043(A) | 2004-07-01 | Applicant | |
| JP2005160669(A) | 2005-06-01 | Applicant | |
| JP2005170816(A) | 2005-06-01 | Applicant | |
| JP2005528401(A) | 2005-09-01 | Applicant | |
| JP2007500673(A) | 2007-01-01 | Applicant | |
| JP2007503881(A) | 2007-03-01 | Applicant | |
| JP2007528848(A) | 2007-10-01 | Applicant | |
| JP2009519042(A) | 2009-05-01 | Applicant | |
| JP2009521406(A) | 2009-06-01 | Applicant | |
| JP2009540921(A) | 2009-11-01 | Applicant | |
| JP2010508976(A) | 2010-03-01 | Applicant | |
| WO-9616086(A1) | 1996-05-01 | Applicant | |
| WO-98012228(A1) | 1998-03-01 | Applicant | |
| WO-9951259(A2) | 1999-10-01 | Applicant | |
| WO-0050006(A2) | 2000-08-01 | Applicant | |
| WO-0135932(A2) | 2001-05-01 | Applicant | |
| WO-0216557(A2) | 2002-02-01 | Applicant | |
| WO-2002040071(A1) | 2002-05-01 | Applicant | |
| WO-2002058723(A2) | 2002-08-01 | Applicant | |
| WO-03020884(A2) | 2003-03-01 | Applicant | |
| WO-04006990(A2) | 2004-01-01 | Applicant | |
| WO-04030706(A2) | 2004-04-01 | Applicant | |
| WO-2004029230(A2) | 2004-04-01 | Applicant | |
| WO-2004031371(A2) | 2004-04-01 | Applicant | |
| WO-04089413(A1) | 2004-10-01 | Applicant | |
| WO-2005013896(A2) | 2005-02-01 | Applicant | |
| WO-2005013933(A1) | 2005-02-01 | Applicant | |
| WO-05026318(A2) | 2005-03-01 | Applicant | |
| WO-05037190(A2) | 2005-04-01 | Applicant | |
| WO-05037293(A1) | 2005-04-01 | Applicant | |
| WO-05046748(A1) | 2005-05-01 | Applicant | |
| WO-05072088(A2) | 2005-08-01 | Applicant | |
| WO-06119619(A1) | 2006-11-01 | Applicant | |
| WO-06136905(A2) | 2006-12-01 | Applicant | |
| WO-07030901(A1) | 2007-03-01 | Applicant | |
| WO-07064152(A1) | 2007-06-01 | Applicant | |
| WO-07070660(A2) | 2007-06-01 | Applicant | |
| WO-2007063075(A1) | 2007-06-01 | Applicant | |
| WO-07078196(A1) | 2007-07-01 | Applicant | |
| WO-07107739(A1) | 2007-09-01 | Applicant | |
| WO-07150020(A1) | 2007-12-01 | Applicant | |
| WO-08018707(A1) | 2008-02-01 | Applicant | |
| WO-2008109852(A2) | 2008-09-01 | Applicant | |
| WO-2008114149(A2) | 2008-09-01 | Applicant | |
| WO-09002401(A2) | 2008-12-01 | Applicant | |
| WO-2008148761(A1) | 2008-12-01 | Applicant | |
| WO-2008157394(A2) | 2008-12-01 | Applicant | |
| WO-09005769(A2) | 2009-01-01 | Applicant | |
| WO-2009018500(A1) | 2009-02-01 | Applicant | |
| WO-09074341(A1) | 2009-06-01 | Applicant | |
| WO-2009072767(A2) | 2009-06-01 | Applicant | |
| WO-09102465(A2) | 2009-08-01 | Applicant | |
| WO-09146456(A1) | 2009-12-01 | Applicant | |
| WO-09155583(A1) | 2009-12-01 | Applicant | |
| WO-2010078209(A2) | 2010-07-01 | Applicant | |
| WO-10120749(A2) | 2010-10-01 | Applicant | |
| WO-11014871(A1) | 2011-02-01 | Applicant | |
| WO-11063336(A2) | 2011-05-01 | Applicant | |
| WO-11109834(A2) | 2011-09-01 | Applicant | |
| WO-11130753(A2) | 2011-10-01 | Applicant | |
| WO-11150240(A1) | 2011-12-01 | Applicant | |
| WO-11151431(A1) | 2011-12-01 | Applicant | |
| WO-11163669(A2) | 2011-12-01 | Applicant | |
| WO-12009611(A2) | 2012-01-01 | Applicant | |
| WO-12019049(A1) | 2012-02-01 | Applicant | |
| WO-12048165(A2) | 2012-04-01 | Applicant | |
| WO-12064697(A2) | 2012-05-01 | Applicant | |
| WO-12148684(A1) | 2012-11-01 | Applicant | |
| WO-12149358(A1) | 2012-11-01 | Applicant | |
| WO-12167230(A1) | 2012-12-01 | Applicant | |
| WO-13106852(A1) | 2013-07-01 | Applicant | |
| WO-13158673(A1) | 2013-10-01 | Applicant | |
| WO-15168379(A2) | 2015-11-01 | Applicant | |
| WO-16123573(A1) | 2016-08-01 | Applicant | |
| WO-2016161372(A1) | 2016-10-01 | Applicant |
Non-Patent Literature (776)
- Champion et al., Shape induced inhibition of phagocytosis of polymer particles. Pharm. Res. 26, 244-249, 2009.Examiner
- “Collagen: The Fibrous Proteins of the Matrix.” Molecular Cell Biology. Lodish et al., eds. New York: W.H. Freeman. Section 22.3(2000):979-985.Applicant
- Agache et al.“Mechanical Properties and Young's Modulus of Human Skin in Vivo.” Arch. Dermatol. Res. 269.3(1980):221-232.Applicant
- Aguado et al. “Improving Viability of Stem Cells During Syringe Needle Flow Through the Design of Hydrogel Cell Carriers.” Tissue Eng. Part A. 18.7-8(2012):806-815.Applicant
- Akpalo et al. “Fibrin-Polyethylene Oxide Interpenetrating Polymer Networks: New Self-Supported Biomaterials Combining the Properties of Both Protein Gel and Synthetic Polymer.” Acta Biomater. 7.6(2011):2418-2427.Applicant
- American Diabetes Association. “Standards of Medical Care in Diabetes—2013.” Diabetes Care. 36.S1(2013):S11-S66.Applicant
- Annaidh et al. “Characterization of the Anistropic Mechanical Properties of Excised Human Skin.” J. Mech. Behav. Biomed. Mater. 5.1(2012):139-148.Applicant
- Aschner et al. “Metabolic Memory for Vascular Disease in Diabetes.” Diabetes Technol. Ther. 14.S1(2012):S68-S74.Applicant
- Aubin et al. “Directed 3D Cell Alignment and Elongation in Microengineered Hydrogels.” Biomater. 31.27(2010):6941-6951.Applicant
- Babensee et al. “Host Response to Tissue Engineered Device.” Adv. Drug Deli. Rev. 33.1-2(1998):111-139.Applicant
- Becker et al. “Cytological Demonstration of the Clonal Nature of Spleen Colonies Derived from Transplanted Mouse Marrow Cells.” Nature. 197(1963):452-454.Applicant
- Bell. “Models for the Specific Adhesion of Cells to Cells.” Science. 200.4342(1978):618-627.Applicant
- Bencherif et al. “Influence of Cross-Linker Chemistry on Release Kinetics of PEG-co-PGA Hydrogels.” J. Biomed. Mater. Res. A. 90.1(2009):142-153.Applicant
- Bencherif et al. “End-Group Effects on the Properties of PEG-co-PGA Hydrogels.” Acta Biomater. 5.6(2009):1872-1883.Applicant
- Bencherif et al. “Influence of the Degree of Methacrylation of Hyaluronic Acid Hydrogels Properties.” Biomater. 29.12(2008):1739-1749.Applicant
- Bencherif et al. “Injectable Preformed Scaffolds with Shape-Memory Properties.” PNAS. 109.48(2012):19590-19595.Applicant
- Bencherif et al. “Nanostructured Hybrid Hydrogels Prepared by a Combination of Atom Transfer Radical Polymerization and Free Radical Polymerization.” Biomater. 30.29(2009):5270-5278.Applicant
- Bencherif et al. “Synthesis by AFET ATEP of Degradable Nanogel Precursors for in situ Formation of Nanostructured Hyaluronic Acid Hydrogel.” Biomacromol. 10.9(2009):2499-2507.Applicant
- Benton et al. “Photocrosslinking of Gelatin Macromers to Synthesize Porous Hydrogels that Promote Valvular Interstitial Cell Function.” Tissue Eng. Part A. 15.11(2009):3221-3230.Applicant
- Berg et al. “IL-10 is a Central Regulator of Cyclooxygenase-2 Expression and Prostaglandin Production.” J. Immunol. 166.4(2001):2674-2680.Applicant
- Bergstraesser et al. “Stimulation and Inhibition of Human Mammary Epithelial Cell Duct Morphogenesis in Vitro.” Proc. Assoc. Am. Physicians. 108.2(1996):140-154.Applicant
- Bianco et al. “The Meaning, the Sense and the Significance: Translating the Science of Mesenchymal Stem Cells into Medicine.” Nat. Med. 19.1(2013):35-42.Applicant
- Bilodeau et al. “Regular Pyramid Punch Problem.” J. Appl. Mech. 59.3(1992):519-523.Applicant
- Boateng et al. “Wound Healing Dressings and Drug Delivery Systems: A Review.” J. Pharm. Sci. 97.8(2008):2892-2923.Applicant
- Boerckel et al. “Mechanical Regulation of Vascular Growth and Tissue Regeneration in vivo.” PNAS. 108.37(2011):E674-E680.Applicant
- Brignone et al. “A Phase I Phamacokinetic and Biological Correlative Study of IMP321, a Novel MHC Class II Agonist, in Patients with Advanced Renal Cell Carcinoma.” Clin. Cancer Res. 15.19(2009):6225-6231.Applicant
- Broxmeyer et al. “Insights into the Biology of Cord Blood Stem/Progenitor Cells.” Cell Prolif. 44.S1(2011):55-59.Applicant
- Buckwalter et al. “Form of Antigen Dictates Immunity: Irradiated Cell vs. Whole Cell Lysate Vaccination.” J. Immunol. 178(2007).Applicant
- Bullard et al. “Fetal Wound Healing: Current Biology.” World J. Surg. 27.1(2003):54-61.Applicant
- Buonaguro et al. “Translating Tumor Antigens into Cancer Vaccines.” Clin. Vaccine Immunol. 18.1(2011):23-34.Applicant
- Burdick et al. “Controlled Degradation and Mechanical Behavior of Photopolymerized Hyaluronic Acid Networks.” Biomacromol. 6.1(2005):386-391.Applicant
- Burdick et al. “Photoencapsulation of Osteoblasts in Injectable RGD-Modified PEG Hydrogels for Bone Tissue Engineering.” Biomater. 23.22(2002):4315-4323.Applicant
- Bégué et al. “Vaccination Against Human Papillomavirus. Implementation and Efficacy Against Cervical Cancer Control.” Bull. Acad. Natl. Med. 191.9(2007):1805-1816. (French original and English abstract).Applicant
- Bürger et al. “Effect of VEGF and its Receptor Antagonist SU-5416, an Inhibitor of Angiogenesis, on Processing of the β-amyloid Precursor Protein in Primary Neuronal Cells Derived From Brain Tissue of Tg2576 Mice.” Int. J. Dev. Neurosci. 28.7(2010):597-604.Applicant
- Cameron et al. “The Influence of Substrate Creep on Mesenchymal Stem Cell Behaviour and Phenotype.” Biomater. 32.26(2011):5979-5993.Applicant
- Caulfield et al. “Regulation of Major Histocompatibility Complex Class II Antigens on Human Alveolar Macrophages by Granulocyte-Macrophage Colony-Stimulating Factor in the Presence of Glucocorticoids.” Immunol. 98.1(1999):104-110.Applicant
- Ceriello et al. “The ‘Metabolic Meory’: Is more than just Tight Glucose Control Necessary to Prevent Diabetic Complications?” J. Clin. Endocrinol. Metab. 94.2(2009):410-415.Applicant
- Ceriello et al. “The Emerging Challenge in Diabetes: The ‘Metabolic Memory.’” Vascular Pharmacol. 57.5-6(2012):133-138.Applicant
- Chan et al. “Traction Dynamics of Filopodia on Compliant Substrates.” Science. 322.5908(2008):1687-1691.Applicant
- Chang. “Mouse Models for Studies of Retinal Degeneration and Diseases.” Methods Mol. Biol. 935(2013):27-39.Applicant
- Chen et al. “Functional Human Vascular Network Generated in Photocrosslinkable Gelatin Methacrylate Hydrogels.” Adv. Funct. Mater. 22.10(2012):2027-2039.Applicant
- Chiang et al. “Whole Tumor Antigen Vaccines.” Semin. Immunol. 22.3(2010):132-143.Applicant
- Clark et al. “Myosin II and Mechanotransduction: A Balancing Act.” Trends Cell Biol. 17.4(2007):178-186.Applicant
- Cook et al. “A Sialomucopeptide Liberated by Trypsin from the Human Erythrocyte.” Nature. 188(1960):1011-1012.Applicant
- Cooper. “Metabolic Memory: Implications for Diabetic Vascular Complications.” Pediatr. Diabetes. 10.5(2009):343-346.Applicant
- Cuda et al. “In Vitro Actin Filament Sliding Velocities Produced by Mixtures of Different Types of Myosin.” Biophys. J. 72.4(1997):1767-1779.Applicant
- Cukierman et al. “Taking Cell-Matrix Adhesions to the Third Dimension.” Science. 294.5547(2001):1708-1712.Applicant
- David et al. “The in vitro Desensitization of Sensitive Cells by Trypsin.” J. Exp. Med. 120(1964):1189-1200.Applicant
- Davies et al. “Antibody-Antigen Complexes.” Annu. Rev. Biochem. 59(1990):439-473.Applicant
- de Jong et al. “Regulation of Notch Signaling Genes During BMP2-Induced Differentiation of Osteoblast Precursor Cells.” Biochem. Biophys. Res. Commun.320(2004):100-107.Applicant
- Dembo et al. “Stresses at the Cell-to-Substrate Interface During Locomotion of Fibroblasts.” Biophys. J. 76.4(1999):2307-2316.Applicant
- Dexter et al. “Conditions Controlling the Proliferation of Haemopoietic Stem Cells In Vitro.” J. Cell. Physiol. 91.3(1977):335-344.Applicant
- Di Nicola et al. “Human Bone Marrow Stromal Cells Suppress T-Lymphocyte Proliferation Induced by Cellular or Nonspecific Mitogenic Stimuli.” Blood. 99.10(2002):3838-3843.Applicant
- Diduch et al. “Two Cell Lines from Bone Marrow tht Differ in Terms of Collagen Synthesis, Osteogenic Characteristics, and Matrix Mineralization.” J. Bone Joint Surg. Am. 75.1(1993):92-105.Applicant
- Diridollou et al. “Skin Ageing: Changes of Physical Properties of Human Skin in vivo.” J. Cosmet. Sci. 23.6(2001):353-362.Applicant
- Discher et al. “Tissue Cells Feel and Respond to the Stiffness of their Substrate.” Science. 310.5751(2005):1139-1143.Applicant
- Disis et al. “Granulocyte-Macrophage Colony-Stimulating Factor: An Effective Adjuvant for Protein and Peptide-Based Vaccines.” Blood. 88.1(1996):202-210.Applicant
- Donati et al. “New Hypothesis on the Role of Alternating Sequences in Calcium-Alginate Gels.” Biomacromol. 6.2(2005):1031-1040.Applicant
- Douay et al. “Ex vivo Production of Human Red Blood Cells from Hematopoietic Stem Cells: What is the Future in Transfusion?” Transfus. Med. Rev. 21.2(2007):91-100.Applicant
- Dranoff. “GM-CSF-Based Cancer Vaccines.” Immunol. Rev. 188(2002):147-154.Applicant
- DuFort et al. “Balancing Forces: Architectural Control of Mechanotransduction.” Nat. Rev. Mol. Cell Biol. 12.5(2011):308-319.Applicant
- Dupont et al. “Role of YAP/TAZ in Mechanotransduction.” Nature. 474.7350(2011):179-183.Applicant
- Edwards et al. “Evaluation of Biomechanical Properties of Human Skin.” Clin. Dermatol. 13.4(1995):375-380.Applicant
- Eming et al. “Inflammation in Wound Repair: Molecular and Cellular Mechanisms.” J. Invest. Dermatol. 127.3(2007):514-525.Applicant
- Engler et al. “Microtissue Elasticity: Measurements by Atomic Force Microscopy and its Influence on Cell Differentiation.” Methods Cell. Biol. 83(2007):521-545.Applicant
- Engler et al. “Substrate Compliance Versus Ligand Density in Cell on Gel Response.” Biophys. J. 86.1 Pt1(2004):617-628.Applicant
- Exposito et al. “The Fibrallar Collagen Family.” Int. J. Mol. Sci. 11.2(2010):407-426.Applicant
- Falanga. “Wound Healing and its Impairment in the Diabetic Foot.” Lancet. 366.9498(2005):1736-1743.Applicant
- Fauquemberque et al. “HLA-A*0201-Restricted CEA-Derived Peptide CAP1 is not a Suitable Target for T-Cell-Based Immunotherapy.” J. Immunother. 33.4(2010):402-413.Applicant
- Fisher et al. “The Study of Protein Mechanics with the Atomic Force Microscope.” Trends Biochem. Sci. 24.10(1999):379-384.Applicant
- Friedenstein et al. “Fibroblast Precursors in Normal and Irradiated Mouse Hematopoietic Organs.” Exp. Hematol. 4.5(1976):267-274.Applicant
- Gardel et al. “Traction Stress in Focal Adhesions Correlates Biphasically with Actin Retrograde Flow Speed.” J. Cell Biol. 183.6(2008):999-1005.Applicant
- Gasic et al. “Removal and Regeneration of the Cell Coating in Tumour Cells.” Nature. 196(1962):170.Applicant
- Gauthier et al. “Temporary Increase in Plasma Membrane Tension Coordinates the Activation of Exocytosis and Contraction During Cell Spreading.” PNAS. 108.35(2011):14467-14472.Applicant
- Geerligs et al. “Linear Viscoelastic Behavior of Subcutaneous Adipose Tissue.” Biorheol. 45.6(2008):677-688.Applicant
- GenBank Accession No. AAA36738.1, Aug. 3, 1993.Applicant
- GenBank Accession No. AAA60022.1, Jan. 7, 1995.Applicant
- GenBank Accession No. AAA64239.1, Mar. 23, 1995.Applicant
- GenBank Accession No. AAB18786.3, Jul. 12, 1999.Applicant
- GenBank Accession No. AAH94877.1, May 20, 2005.Applicant
- GenBank Accession No. AEO22039.1, Sep. 17, 2011.Applicant
- GenBank Accession No. AF344424.1, Apr. 8, 2002.Applicant
- GenBank Accession No. AF414120.1, Sep. 26, 2001.Applicant
- GenBank Accession No. AF450242.1, Feb. 11, 2002.Applicant
- GenBank Accession No. AJ583695.1, Oct. 7, 2008.Applicant
- GenBank Accession No. AY291313.1, Apr. 26, 2004.Applicant
- GenBank Accession No. BC094887.1, Jul. 21, 2006.Applicant
- GenBank Accession No. CAA01955.1, Nov. 14, 2006.Applicant
- GenBank Accession No. DQ103757.1, Jul. 25, 2005.Applicant
- GenBank Accession No. JN602184.1, Sep. 17, 2011.Applicant
- GenBank Accession No. M16006.1, Jan. 7, 1995.Applicant
- GenBank Accession No. M24902.1, Jan. 7, 1995.Applicant
- GenBank Accession No. M73239.1, Mar. 23, 1995.Applicant
- GenBank Accession No. NM_000091.4, May 10, 2014.Applicant
- GenBank Accession No. NM_000572.2, May 18, 2014.Applicant
- GenBank Accession No. NM_000638.3, May 4, 2014.Applicant
- GenBank Accession No. NM_000758.3, May 4, 2014.Applicant
- GenBank Accession No. NM_000885.4, Apr. 13, 2014.Applicant
- GenBank Accession No. NM_000963.3, Jun. 13, 2014.Applicant
- GenBank Accession No. NM_001001522.1, May 18, 2014.Applicant
- GenBank Accession No. NM_001845.4, May 3, 2014.Applicant
- GenBank Accession No. NM_001901.2, May 18, 2014.Applicant
- GenBank Accession No. NM_002421.3_May 11, 2014.Applicant
- GenBank Accession No. NM_002982.3, May 3, 2014.Applicant
- GenBank Accession No. NM_003377.4, May 5, 2014.Applicant
- GenBank Accession No. NM_003392.4, May 5, 2014.Applicant
- GenBank Accession No. NM_004469.4, May 25, 2014.Applicant
- GenBank Accession No. NM_005429.3, Mar. 31, 2014.Applicant
- GenBank Accession No. NM_015719.3, Feb. 26, 2014.Applicant
- GenBank Accession No. NP_000082.2, May 10, 2014.Applicant
- GenBank Accession No. NP_000629.3, May 4, 2014.Applicant
- GenBank Accession No. NP_000749.2, May 4, 2014.Applicant
- GenBank Accession No. NP_000876.3, Apr. 13, 2014.Applicant
- GenBank Accession No. NP_000954.1, Jun. 13, 2014.Applicant
- GenBank Accession No. NP_001001522.1, May 18, 2014.Applicant
- GenBank Accession No. NP_001836.2, May 3, 2014.Applicant
- GenBank Accession No. NP_001892.1, May 18, 2014.Applicant
- GenBank Accession No. NP_002973.1, May 3, 2014.Applicant
- GenBank Accession No. NP_003239.2, Feb. 18, 2014.Applicant
- GenBank Accession No. NP_003368.1, May 5, 2014.Applicant
- GenBank Accession No. NP_003383.2, May 5, 2014.Applicant
- GenBank Accession No. NP_004460.1, May 25, 2014.Applicant
- GenBank Accession No. NP_005420.1, May 11, 2014.Applicant
- GenBank Accession No. NP_056534.2, Feb. 26, 2014.Applicant
- GenBank Accession No. U76381.2, Jul. 12, 1999.Applicant
- Genes et al. “Effect of Substrate Mechanics on Chondrocyte Adhesion to Modified Alginate Surfaces.” Arch. Biochem. Biophys. 422.2(2004):161-167.Applicant
- Graessley. “Entangled Linear, Branched and Network Polymer Systems—Molecular Theories.” Adv. Poly. Sci. 47(1982):67-117.Applicant
- Guillaume et al. “Two Abundant Proteasome Subtypes that Uniquely Process Some Antigens Presented by HLA Class I Molecules.” PNAS. 107.43(2010):18599-18604.Applicant
- Guo et al. “Droplet Microfluidics for High-Throughput Biological Assays.” Lab Chip. 12.12(2012):2146-2155.Applicant
- Gurkan et al. “The Mechanical Environment of Bone Marrow: A Review.” Ann. Biomed. Eng. 36.12(2008):1978-1991.Applicant
- Halim et al. “Biologic and Synthetic Skin Substitutes: An Overview.” Indian J. Plast. Surg. 43(2010):S23-S28.Applicant
- Harris. “Classification, Diagnostic Criteria, and Screening for Diabetes.” Diabetes in America. NIH Publication No. 95-1468. Chapter 2. (1995):15-36.Applicant
- Holland et al. “Transforming Growth Factor-β1 Release from Oligo(poly(ethylene glycol) Fumarate) Hydrogels in Conditions that Model the Cartilage Wound Healing Environment.” J. Control. Release. 94(2004):101-114.Applicant
- Humphries et al. “Integrin Ligands at a Glance.” J. Cell. Sci. 119.Pt19(2006):3901-3903.Applicant
- Huston et al. “Protein Engineering of Antibody Binding Sites: Recovery of Specific Activity in an Anti-Digoxin Single-Chain Fv Analogue Produced in Escherichia coli.” PNAS. 85.16(1988):5879-5883.Applicant
- Hutson et al. “Synthesis and Characterization of Tunable Poly(ethylene Glycol): Gelatin Methacrylate Composite Hydrogels.” Tissue Eng. Part A. 17.13-14(2011):1713-1723.Applicant
- lhnat et al. “Hypothesis: The ‘Metabolic Memory’, the New Challenge of Diabetes.” Diabet. Med. 24.6(2007)582-586.Applicant
- Isern et al. “Self-Renewing Human Bone Marrow Mesenspheres Promote Hematopoietic Stem Cell Expansion.” Cell Rep. 3.5(2013):1714-1724.Applicant
- Janmey et al. “From Tissue Mechanics to Transcription Factors.” Differentiation. 86.3(2013):112-120.Applicant
- Jiang et al. “Two-Piconewton Slip Bond Between Fibronectin and the Cytoskeleton Depends on Talin.” Nature. 424.6946(2003):334-337.Applicant
- Jokinen et al. “Integrin-Mediated Cell Adhesion to Type I Collagen Fibrils.” J. Biol. Chem. 279.30(2004):31956-31963.Applicant
- Jugdutt et al. “Aging and Defective Healing, Adverse Remodeling, and Blunted Post-Conditioning in the Reperfused Wounded Heart.” J. Am. Coll. Cardiol. 51.14(2008):1399-1403.Applicant
- Kang et al. “Effect of Porous Structure on the Degradation of Freeze-Dried Gelatin Hydrogels.” J. Bioact. Compat. Poly. 14.4(1999):331-343.Applicant
- Katayama et al. “Integrated Analysis of the Genome and the Transcriptome by FANTOM.” Brief Bioinform. 5.3(2004):249-258.Applicant
- Kearney et al. “Macroscale Delivery Systems for Molecular and Cellular Payloads.” Nat. Mater. 12.11(2013):1004-10017.Applicant
- Kennedy et al. “Rapid and Extensive Collapse from Electrically Responsive Macroporous Hydrogels.” Adv. Healthc. Mater. 3.4(2014):500-507.Applicant
- Khetan et al. “Degradation-Mediated Cellular Traction Directs Stem Cell Fate in Covalently Crosslinked Three-Dimensional Hydrogels.” Nat. Mater. 12.5(2013):458-465.Applicant
- Klein et al. “Cell-Cycle Control by Physiological Matrix Elasticity and In Viivo Tissue Stiffening.” Curr. Biol. 19.18(2009):1511-1518.Applicant
- Kohane. “Microparticles and Nanoparticles for Drug Delivery.” Biotechnol. Bioeng. 96.2(2007):203-209.Applicant
- Kong et al. “FRET Measurements of Cell-Traction Forces and Nano-Scale Clustering of Adhesion Ligands Varied by Substrate Stiffness.” PNAS. 102.12(2005):4300-4305.Applicant
- Kratky et al. “Direct Activation of Antigen-Presenting Cells is Required for CD8+ T-Cell Priming and Tumor Vaccination.” PNAS. 108.42(2011):17414-17419.Applicant
- Kuwahara et al. “Cell Delivery Using an Injectable and Adhesive Transglutaminase-Gelatin Gel.” Tissue Eng. Part C Methods. 16.4(2010):609-618.Applicant
- Lee et al. “Intravenous hMSCs Improve Myocardial Infarction in Mice because Cells Embolized in Lung are Activated to Secrete the Anti-Inflammatory Protein TSG-6.” Cell Stem Cell. 5.1(2009):54-63.Applicant
- Lele et al. “Investigating Complexity of Protein-Protein Interactions in Focal Adhesions.” Biochem. Biophys. Res. Commun. 369.3(2008):929-934.Applicant
- Levental et al. “Soft Biological Materials and their Impact on Cell Function.” Soft Matter. 3(2007):299-306.Applicant
- Li et al. “A Novel Cyclohexene Derivate, Ethyl (6R)-6-[N-(2-Chloro-4-fluorophenyl)sulfamoyl]cyclohex-1-ene-1-carboxylate (TAK-242), Selectively Inhibits Toll-Like Receptor 4-Mediated Cytokine Production Through Suppression of Intracellular Signaling.” Mol. Pharmacol. 69.4(2006):1288-1295.Applicant
- Li et al. “Purified Hybrid Cells from Dendritic Cell and Tumor Cell Fusions are Superior Activators of Antitumor Immunity.” Cancer Immunol. Immunother. 50.9(2001):456-462.Applicant
- Lin et al. “Transdermal Regulation of Vascular Network Bioengineering Using a Photopolymerizable Methacrylated Gelatin Hydrogel.” Biomater. 34.28(2013):6785-6796.Applicant
- Liu et al. “Heterobifunctional Poly(Ethylene Glycol)—Tethered Bone Morphogenetic Protein-2-Stimulated Bone Marrow Mesenchymal Stromal Cell Differentiation and Osteogenesis.” Tissue Eng. 13.5(2007)1113-1124.Applicant
- Liu et al. “On the Viscoelastic Character of Liver Tissue: Experiments and Modelling of the Linear Behaviour.” Biorheol. 37.3(2000):191-201.Applicant
- Lo et al. “Cell Movement is Guided by the Rigidity of the Substrate.” Biophys. J. 79.1(2000):144-152.Applicant
- Ludewig et al. “Immunotherapy with Dendritic Cells Directed Against Tumor Antigens Shared with Normal Host Cells Results in Severe Autoimmune Disease.” J. Exp. Med. 191.5(2000):795-804.Applicant
- Majeti et al. “Identification of a Hierarchy of Multipotent Hematopoietic Progenitors in Human Cord Blood.” Cell Stem Cell. 1.6(2007):635-645.Applicant
- Malmqvist. “Biospecific Interaction Analysis Using Biosensor Technology.” Nature. 361.6408(1993):186-187.Applicant
- Mammoto et al. “Mechanical Control of Tissue and Organ Development.” Development. 137.9(2010):1407-1420.Applicant
- Manayski et al. “Vascular Niche Controls Organ Regeneration.” Circ. Res. 114.17(2014):1077-1079.Applicant
- Mansoor et al. “Engineering T Cells for Cancer Therapy.” Br. J. Cancer. 93.10(2005):1085-1091.Applicant
- Masedunskas et al. “Role for the Actomyosin Complex in Regulated Exocytosis Revealed by Intravital Microscopy.” PNAS. 108.33(2011):13552-13557.Applicant
- McDonald et al. “Early Fracture Callus Displays a Smooth Muscle-Like Viscoelastic Properties Ex Viivo: Implications for Fracture Healing.” J. Orthop. Res. 27.11(2009):1508-1513.Applicant
- McKinnon et al. “Biophysically Defined and Cytocompatible Covalently Adaptable Networks as Viscoelastic 3D Cell Culture Systems.” Adv. Mater. 26.6(2014):865-872.Applicant
- McWhorter et al. “Modulation of Macrophage Phenotype by Cell Shape.” PNAS. 110.43(2013):17253-17258.Applicant
- Melief et al. “Immunotherapy of Established (Pre)Malignant Disease by Synthetic Long Peptide Vaccines.” Nat. Rev. Cancer. 8(2008):351-360.Applicant
- Merkel et al. “Using Mechanobiological Mimicry of Red Blood Cells to Extend Circulation Times of Hydrogel Microparticles.” PNAS. 108.2(2011):586-591.Applicant
- Metters et al. “Fundamental Studies of Biodegradable Hydrogels as Cartilage Replacement Materials.” Biomed. Sci. Instrum. 35(1999):33-38.Applicant
- Miljkovic et al. “Chondrogenesis, Bone Morphogenetic Protein-4 and Mesenchymal Stem Cells.” Osteoarthritis Cartilage. 16(2008):1121-1130.Applicant
- Miller et al. “Melanoma.” N. Engl. J. Med. 355.1(2006):51-65.Applicant
- Miralles et al. “Actin Dynamics Control SRF Activity by Regulation of its Coactivator MAL.” Cell. 113.3(2003):329-342.Applicant
- Molinari et al. “Modification of Surface Membrane Antigens by Trypsin.” Proc. Soc. Exp. Biol. Med. 148.4(1975):991-994.Applicant
- Molloy et al. “Movement and Force Produced by a Single Myosin Head.” Nature. 378.6553(1995):209-212.Applicant
- Mooney et al. “Cytoskeletal Filament Assembly and the Control of Cell Spreading and Function by Extracellular Matrix.” J. Cell Sci. 108(1995):2311-2320.Applicant
- Muralidharan-Chari et al. “ARF6-Regulated Shedding of Tumor Cell-Derived Plasma Membrane Microvesicles.” Curr. Biol. 19.22(2009):1875-1885.Applicant
- NCBI Accession No. NM_001561.5, Mar. 16, 2014.Applicant
- NCBI Accession No. NM_004448.3, Apr. 23, 2014.Applicant
- NCBI Accession No. NM_005018.2, Apr. 27, 2014.Applicant
- NCBI Accession No. NM_181780.3, Jan. 27, 2014.Applicant
- NCBI Accession No. NP_001193, May 3, 2014.Applicant
- NCBI Accession No. NP_001552.2, Mar. 16, 2014.Applicant
- NCBI Accession No. NP_003237.2, May 25, 2014.Applicant
- NCBI Accession No. NP_003318.1, May 4, 2014.Applicant
- NCBI Accession No. NP_003327.3, May 4, 2014.Applicant
- NCBI Accession No. NP_005009.2, Apr. 27, 2014.Applicant
- NCBI Accession No. NP_861445.3, Jan. 27, 2014.Applicant
- Nichol et al. “Cell-Laden Microengineered Gelatin Methacrylate Hydrogels.” Biomater. 31.21(2010):5536-5544.Applicant
- Niessen et al. “The α6β4 Integrin is a Receptor for Both Lamin and Kalinin.” Exp. Cell Res. 211.2(1994):360-367.Applicant
- Osunkoya et al. “Synthesis and Fate of Immunological Surface Receptors on Cultured Burkitt Lymphoma Cells.” Int. J. Cancer. 4.2(1969):159-165.Applicant
- Page-McCaw et al. “Matrix Metalloproteinases and the Regulation of Tissue Remodelling.” Nat. Rev. Mol. Cell Biol. 8.3(2007):221-233.Applicant
- Pailler-Mattei et al. “In vivo Measurements of the Elastic Mechanical Properties of Human Skin by Indentation Tests.” Med. Eng. Phys. 30.5(2008):599-606.Applicant
- Pardoll. “The Blockade of Immune Checkpoints in Cancer Immunotherapy.” Nat. Rev. Cancer. 12.4(2012):252-264.Applicant
- Parekh et al. “Modulus-Driven Differentiation of Marrow Stromal Cells in 3D Scaffolds that is Independent of Myosin-Based Cytoskeletal Tension.” Biomater. 32.9(2011):2256-2264.Applicant
- Parekkadan et al. “Mesenchymal Stem Cell-Derived Molecules Reverse Fulminant Hepatic Failure.” PLoS One. 2.9(2007):e941.Applicant
- Park et al. “Photopolymerized Hyaluronic Acid-Based Hydrogels and Interpenetrating Networks.” Biomater. 24.6(2003):893-900.Applicant
- Pawlaczyk et al. “Age-Dependent Biomechanical Properties of the Skin.” Postepy. Dermatol. Alergol. 30.5(2013):302-306.Applicant
- Pek et al. “The Effect of Matrix Stiffness on Mesenchymal Stem Cell Differentiation in a 3D Thixotropic Gel.” Biomater. 31.3(2010):385-391.Applicant
- Pena et al. “Effects of TGF-β and TGF-β Neutralizing Antibodies on Fibroblast-Induced Collagen Gel Contraction: Implications for Proliferative Vitroretinpathy.” Invest. Ophthalmol. Vis. Sci. 35.6(1994):2804-2808.Applicant
- Peyton et al. “The Use of Poly(ethylene glycol) Hydrogels to Investigate the Impact of ECM Chemistry and Mechanics on Smooth Muscle Cells.” Biomater. 27.28(2006):4881-4893.Applicant
- Pinho et al. “PDGFRα and CD51 Mark Human Nestin+ Sphere-Forming Mesenchymal Stem Cells Capable of Hematopoietic Progenitor Cell Expansion.” J. Exp. Med. 210.7(2013):1351-1367.Applicant
- Qi et al. “Patterned Differentiation of Individual Embryoid Bodies in Spatially Organized 3D Hybrid Microgels.” Adv. Mater. 22.46(2010):5276-5281.Applicant
- Qin et al. “Soft Lithography for Micro- and Nanoscale Patterning.” Nat. Protoc. 5.3(2010):491-502.Applicant
- Raeber et al. “Molecularly Engineered PEG Hydrogels: A Novel Model System for Proteolyrically Mediated Cell Migration.” Biophys. J. 89.2(2005):1374-1388.Applicant
- Ramón-Azcón et al. “Gelatin Methacrylate as a Promising Hydrogel for 3D Microscale Organization and Proliferation of Dielectroretically Patterned Cells.” Lab on a Chip. 12.16(2012):2959-2969.Applicant
- Ranganath et al. “Harnessing the Mesenchymal Stem Cell Secretome for the Treatment of Cardiovascular Disease.” Cell Stem Cell. 10.3(2012):244-258.Applicant
- Raposo et al. “Extracellular Vesicles: Exosomes, Microvesicles, and Friends.” J. Cell. Biol. 200.4(2013):373-383.Applicant
- Roccaro et al. “BM Mesenchymal Stromal Cell-Derived Exosomes Facilitate Multiple Myeloma Progression.” J. Clin. Invest. 123.4(2013):1542-1555.Applicant
- Rodriguez et al. “Minimal “Self” Peptides that Inhibit Phagocytic Clearance and Enhance Delivery of Nanoparticles.” Science. 339.6122(2013):971-975.Applicant
- Sacchetti et al. “Self-Renewing Osteoprogenitors in Bone Marrow Sinusoids can Organize a Hematopoietic Microenvironment.” Cell. 131.2(2007):324-336.Applicant
- Sakai et al. “An Injectable, in situ Enzymatically Gellable, Gelatin Derivative for Drug Delivery and Tissue Engineering.” Biomater. 30.20(2009):3371-3377.Applicant
- Schofield. “The Relationship Between the Spleen Colony-Forming Cell and the Haemopoietic Stem Cell.” Blood. Cells. 4.1-2(1978):7-25.Applicant
- Schwartz. “Integrins and Extracellular Matrix in Mechanotransduction.” Cold Spring Harb. Perspect. Biol. 2.12(2010):a005066.Applicant
- Sensi et al. “Unique Tumor Antigens: Evidence for Immune Control of Genome Integrity and Immunogenic Targets for T Cell-Mediated Patient-Specific Immunotherapy.” Clin. Cancer Res. 12.17(2006):5023-5032.Applicant
- Shi et al. “Granulocyte-Macrophage Colony-Stimulating Factor (GM-CSF) and T-Cell Responses: What we do and don't know.” Cell Res. 16.2(2006):126-133.Applicant
- Shin et al. “Contractile Forces Sustain and Polarize Hematopoiesis from Stem and Progenitor Cells.” Cell Stem Cell. 14.1(2014):81-93.Applicant
- Shin et al. “Lamins Regulate Cell Trafficking and Lineage Maturation of Adult Human Hematopoetic Cells.” PNAS. 110.47(2013):18892-18897.Applicant
- Shin et al. “Myonsin-II Inhibition and Soft 2D Matrix Maximize Multinucleation and Cellular Projections Typical of Platelet-Producing Megakaryocytes.” PNAS. 108.28(2011):11458-11463.Applicant
- Siegwart et al. “Synthesis, Characterization, and in vitro Cell Culture Viability of Degradable Poly(N-isopropylacrylamide-co-5,6-benzo-2-methylene-1,3-dioxepane)-Based Polymers and Crosslinked Gels.” J. Biomed. Mater. Res. A. 87.2(2008):345-358.Applicant
- Silva et al. “Effects of VEGF Temporal and Spatial Presentation on Angiogenesis.” Biomaterials. 31.6(2010):1235-1241.Applicant
- Singer et al. “Cutaneous Wound Healing.” N. Engl. J. Med. 341.10(1999):738-746.Applicant
- Solon et al. “Fibroblast Adaptation and Stiffness Matching to Soft Elastic Substrates.” Biophys. J. 93.12(2007):4453-4461.Applicant
- Stachowiak et al. “Inverse Opal Hydrogel-Collagen Composite Scaffolds as a Supportive Microenvironment for Immune Cell Migration.” J. Biomed. Mater. Res. 85A(2008):815-828.Applicant
- Sun et al. “Biomimetic Interpenetrating Polymer Network Hydrogels Based on Methacrylated Alginate and Collagen for 3D Pre-Osteoblast Spreading and Osteogenic Differentiation.” Soft Matter. 8(2012):2398-2404.Applicant
- Sun et al. “Highly Stretchable and Tough Hydrogels.” Nature. 489.7414(2012):133-136.Applicant
- Suri et al. “Photopatterned Collagen-Hyaluronic Acid Interpenetrating Polymer Network Hydrogels.” Acta Biomater. 5.7(2009):2385-2397.Applicant
- Swift et al. “Nuclear Lamin-A Scales with Tissue Stiffness and Enhances Matrix-Directed Differentiation.” Science. 341.6149(2013):1240104.Applicant
- Syed et al. “Stem Cell Therapy Market.” Nat. Rev. Drug Discov. 12.3(2013):185-186.Applicant
- Tabata et al. “Enhanced Vascularization and Tissue Granulation by Basic Fibroblast Growth Factor Impregnated in Gelatin Hydrogels.” J. Control. Release. 31.2(1994):189-199.Applicant
- Tannous. “Gaussia Luciferase Reporter Assay for Monitoring Biological Processes in Culture and in vivo.” Nat. Protoc. 4.4(2009):582-591.Applicant
- Thomas et al. “Intravenous Infusion of Bone Marrow in Patients Receiving Radiation and Chemotherapy.” N. Engl. J. Med. 257.11(1957):491-496.Applicant
- Thurner et al. “Vaccination with Mage-3A1 Peptide-Pulsed Mature, Monocyte-Derived Dendritic Cells Expands Specific Cytotoxic T Cells Induces Regression of Some Metastases in Advanced Stage IV Melanoma.” J. Exp. Med. 190.11(1999):1669-1678.Applicant
- Tong et al. “Engineering Interpenetrating Network Hydrogels as Biomimetic Cell Niche with Independently Tunable Biochemical and Mechanical Properties.” Biomater. 35.6(2014):1807-1815.Applicant
- Trappmann et al. “Extracelluar-Matrix Tethering Regulates Stem-Cell Fate.” Nat. Mater. 11.7(2012):642-649.Applicant
- Trappmann et al. “How Cells Sense Extracellular Matrix Stiffness: A Material's Perspective.” Curr. Opin. Biotechnol. 24.5(2013):948-953.Applicant
- Uhlenbruck. “Action of Proteolytic Enzymes on the Human Erythrocyte Surface.” Nature. 190(1961):181.Applicant
- Ulrich et al. “Probing Cellular Mechanobiology in Three-Dimensional Culture with Collagen-Agarose Matrices.” Biomater. 31.7(2010):1875-1884.Applicant
- UniProtKB/Swiss-Prot Accession No. P02751.4, Apr. 16, 2014.Applicant
- UniProtKB/Swiss-Prot Accession No. P02778.2, Jun. 11, 2014.Applicant
- UniProtKB/Swiss-Prot Accession No. P04626.1, Apr. 16, 2014.Applicant
- UniProtKB/Swiss-Prot Accession No. P05121.1, Apr. 16, 2014.Applicant
- UniProtKB/Swiss-Prot Accession No. P05231.1, Jun. 11, 2014.Applicant
- UniProtKB/Swiss-Prot Accession No. P09038.3, Jun. 11, 2014.Applicant
- UniProtKB/Swiss-Prot Accession No. P10145.1, Jun. 11, 2014.Applicant
- UniProtKB/Swiss-Prot Accession No. P13500.1, Jun. 11, 2014.Applicant
- UniProtKB/Swiss-Prot Accession No. P14210.2, Jun. 11, 2014.Applicant
- UniProtKB/Swiss-Prot Accession No. P14780.3, Jun. 11, 2014.Applicant
- UniProtKB/Swiss-Prot Accession No. P14902.1, May 14, 2014.Applicant
- UniProtKB/Swiss-Prot Accession No. P15692.2, Jun. 11, 2014.Applicant
- UniProtKB/Swiss-Prot Accession No. P16035.2, Jun. 11, 2014.Applicant
- UniProtKB/Swiss-Prot Accession No. P16410.3, Apr. 16, 2014.Applicant
- UniProtKB/Swiss-Prot Accession No. P48061.1, Jun. 18, 2014.Applicant
- UniProtKB/Swiss-Prot Accession No. P80162.4, Jun. 11, 2014.Applicant
- UniProtKB/Swiss-Prot Accession No. P98066.2, Feb. 19, 2014.Applicant
- UniProtKB/Swiss-Prot Accession No. Q8TDQ0.3, Mar. 19, 2014.Applicant
- UniProtKB/Swiss-Prot Accession No. Q96HF1.2, May 14, 2014.Applicant
- UniProtKB/Swiss-Prot Accession No. Q9BQ51.2, Mar. 19, 2014.Applicant
- UniProtKB/Swiss-Prot Accession No. Q9HCB6.2, Jun. 11, 2014.Applicant
- UniProtKB/Swiss-Prot Accession No. Q9NZQ7.1, Apr. 16, 2014.Applicant
- van der Bruggen et al. “T Cell-Defined Tumor Antigens.” Cancer Immunity. (2013). Http:www.cancerimmunity.org/peptide.Applicant
- Venturoni et al. “Investigations into the Polymorphism of Rat Tail Tendon Fibrils Using Atomic Force Microscopy.” Biochem. Biophys. Res. Commun. 303.2(2003):508-513.Applicant
- Vincent et al. “Stem Cell Differentiation: Post-Degradation Forces Kick in.” Nat. Mater. 12.5(2013):384-386.Applicant
- Vogel et al. “Local Force and Geometry Sensing Regulate Cell Functions.” Nat. Rev. Mol. Cell Biol. 7.4(2006):265-275.Applicant
- Wang et al. “Mechanotransduction at a Distance: Mechanically Coupling the Extracellular Matric with the Nucleus.” Nat. Rev. Mol. Cell. Biol. 10.1(2009):75-82.Applicant
- Wang-Gillam et al. “A Phase I Study of IMP321 and Gemcitabine as the Front-Line Therapy in Patients with Advanced Pancreatic Adenocarcinoma.” Invest. New Drugs. 31.3(2013):707-713.Applicant
- Warner et al. “Cyclooxygenases: New Forms, New Inhibitors, and Lessons from the Clinic.” FASEB J. 18.7(2004):790-804.Applicant
- Weisenberger et al. “Comprehensive DNA Methylation Analysis on the Illumina® Infinium® Assay Platform.” Illumina, Inc. Mar. 25, 2008. Web.Applicant
- Weiss et al. “The Demonstration of Rupture of Cell Surfaces by an Immunological Technique.” Exp. Cell Res. 30(1963):331-338.Applicant
- Wen et al. “Mechanically Robust Gelatin-Alginate IPN Hydrogels by a Combination of Enzymatic and Ionic Crosslinking Approaches.” Macromol. Mater. Eng. 299(2013):504-513.Applicant
- Wieland et al. “Engineering Molecular Circuits Using Synthetic Biology in Mammalian Cells.” Annu. Rev. Chem. Biomol. Eng. 3(2012):209-234.Applicant
- Wipff et al. “Myofibroblast Contraction Activates Latent TGF-β1 from the Extracellular Matrix.” J. Cell Biol. 179.6(2007):1311-1323.Applicant
- Wong et al. “Focal Adhesion Kinase Links Mechanical Force to Skin Fibrosis via Inflammatory Signaling.” Nat. Med. 18.1(2011):148-152.Applicant
- Wong et al. “Mechanical Force Prolongs Acute Inflammation via T-Cell-Dependent Pathways During Scar Formation.” FASEB. J. 25.12(2011):4498-4510.Applicant
- Wong et al. “Pushing Back: Wound Mechanotransduction in Repair and Regeneration.” J. Invest. Dermatol. 131.11(2011):2186-2196.Applicant
- Wozniak et al. “Mechanotransduction in Development: A Growing Role for Contractility.” Nat. Rev. Mol. Cell Biol. 10.1(2009):34-43.Applicant
- Yeung et al. “Effects of Substrate Stiffness on Cell Morphology, Cytoskeletal Structure, and Adhesion.” Cell Motil. Cytoskeleton. 60.1(2005):24-34.Applicant
- Yoo et al. “Bio-Inspired, Bioengineered and Biomimetic Drug Delivery Carriers.” Nat. Rev. Drug Discov. 10.7(2011):521-535.Applicant
- Yoon. “Hidden Markov Models and their Applications in Biological Sequene Analysis.” Curr. Genomics. 10.6(2009):402-415.Applicant
- Young et al. “Gelatin as a Delivery Vehicle for the Controlled Release of Bioactive Molecules.” J. Control. Release. 109.1-3(2005):256-274.Applicant
- Zemel et al. “Optimal Matrix Rigidity for Stress Fibre Polarization in Stem Cells.” Nat. Phys. 6.6(2010):468-473.Applicant
- Zhang et al. “A Tension-Induced Mechanostransduction Pathway Promotes Epithelial Morphogenesis.” Nature. 471.7336(2011):99-103.Applicant
- Zhang et al. “Talin Depletion Reveals Independence of Initial Cell Spreading from Integrin Activation and Traction.” Nat. Cell Biol. 10.9(2008):1062-1068.Applicant
- Zhao et al. “Stress-Relaxation Behavior in Gels with Ionic and Covalent Crosslinks.” J. Appl. Phys. 107.6(2010):63509.Applicant
- Kathuria et al. “Synthesis and characterization of elastic and macroporous chitosan-gelatin cryogels for tissue engineerin” Act Abiomaterialia 5 (2009) 406-418.Applicant
- Yang, Fan et al., “The effect of incorporating RGD adhesive peptide in polyethylene glycol diacrylate hydrogel on osteogenesis of bone marrow stromal cells,” Biomaterials, vol. 26(2005):5991-5998.Applicant
- Corcione et al. “CCL19 and CXCL12 trigger in vitro chemotaxis of human mantle cell lymphoma B cells.” Clin CancerRes. Feb. 1, 2004;10(3):964-71.Applicant
- Latorre et al. “Applications of magnetic nanoparticles in medicine: magnetic fluid hyperthermia.” P R Health Sci J. Sep. 2009;28(3):227-38.Applicant
- Malhotra et al. “Use of an oncolytic virus secreting GM-CSF as combined oncolytic and immunotherapy for treatment of colorectal and hepatic adenocarcinomas.” Surgery. Apr. 2007;141(4):520-9.Applicant
- Nestle et al. “Vaccination of melanoma patients with peptide- or tumor lysate-pulsed dendritic cells.” Nat Med. Mar. 1998;4(3):328-32.Applicant
- Wang et al. “Photothermal effects of supramolecularly assembled gold nanoparticles for the targeted treatment of cancer cells.” Angew Chem Int Ed Engl. May 17, 2010;49(22):3777-81.Applicant
- Sato, “Human dendritic cells.” Biotherapy. Nov. 2004;18(6):467-77.Applicant
- Annual Review Meneki (Immunity). 2007;2008:122-31.Applicant
- Fransen et al. “Local immunomodulation for cancer therapy: Providing treatment where needed.” Oncoimmunology. Nov. 1, 2013;2(11):e26493.Applicant
- Yamazaki et al., “CD8+CD205+Splenic Dendritic Cells are Specialized to Induce Foxp3+Regulatory T Cells” J. Immunology. (2008) 181:6923-6933.Applicant
- Barrio et al. “A Two-Dimensional Numerical Study of Spatial Pattern Formation in Interacting Turing Systems.” Bull. Math Biol. 61.3(1999):483-505.Applicant
- Liu et al. Immunostimulatory CpG oligodeoxynucleotides enhance the immune response to vaccine strategies involving granulocyte-macrophage colony-stimulating factor. Blood. Nov. 15, 1998;92(10):3730-6.Applicant
- Brunner et al. Enhanced dendritic cell maturation by TNF-alpha or cytidine-phosphate-guanosine DNA drives T cell activation in vitro and therapeutic anti-tumor immune responses in vivo. J Immunol. Dec. 1, 2000;165(11):6278-86.Applicant
- “Antigens and Receptors.” Immunology. Doan et al., eds. Philadelphia: Wolters Kluwer/Lippincott Williams & Wilsons. (2008):11-23.Applicant
- “Transient.” Merriam-Webster Dictionary. Web. Jul. 18, 2014. www.merriam-webster.com/dictionary/transient.Applicant
- “Wound Management: Past, Present, and Future.” Clinicians' Pocket Guide to Chronic Wound Repair. Mulder et al., eds. Springhouse, PA: Springhouse Corporation. (1998):85-90.Applicant
- Abrahams et al. “Expression and Secretion of Antiviral Factors by Trophoblast Cells Following Stimulation by the TLF-3 Agonist, Poly (I:C).” Hum. Reprod. 21.9(2006):2432-2439.Applicant
- Agrawal et al. “Cutting Edge: Different Toll-Like Receptor Agonists Instruct Dendritic Cells to Induce Distinct Th Responses via Differential Modulation of Extracellular Signal-Regulated Kinase-Mitogen-Activated Protein Kinase and c-Fos.” J. Immunol. 171.10(2003):4984-4989.Applicant
- Akira et al. “Pathogen Recognition and Innate Immunity.” Cell. 124.4(2006):783-801.Applicant
- Akira et al. “Toll-Like Receptors: Critical Proteins Linking Innate and Acquired Immunity.” Nat. Immunol. 2.8(2001):675-680.Applicant
- Aldhous. “Print Me a Heart and a Set of Arteries.” New Scientist. 2547(2006):19.Applicant
- Ali et al. “Controlled Local Delivery of GM-CSF From Polymer-Based Vaccines Enhances Anti-Tumor Immune Responses by Priming Host Dendritic Cells.” 2007 AACR Annual Meeting. 48(2007):652. (Abstract #2736).Applicant
- Ali et al. “Converging Cell Therapy with Biomaterials.” Cell Transplantation from Laboratory to Clinic. Burlington, MA: Elsevier, Inc. (2006):591-609.Applicant
- Ali et al. “In situ Regulation of DC Subsets and T Cells Mediates Tumor Regression in Mice.” Sci. Transl. Med. 1.8(2009):8-19.Applicant
- Ali et al. “Infection-Mimicking Materials to Program Dendritic Cells in situ.” Nat. Mater. 8.2(2009):151-158.Applicant
- Ali et al. “Sustained GM-CSF and PEI Condensed pDNA Presentation Increases the Level and Duration of Gene Expression in Dendritic Cells.” J. Control. Release. 132.3(2008):273-278.Applicant
- Allen et al. “Regulation of Satellite Cells During Skeletal Muscle Growth and Development.” Proc. Soc. Exp. Biol. Med. 194.2(1990):81-86.Applicant
- Allen et al. “Regulation of Skeletal Muscle Satellite Cell Proliferation by Bovine Pituitary Fibroblast Growth Factor.” Exp. Cell Res. 152.1(1984):154-160.Applicant
- Almarza et al. “Evaluation of Three Growth Factors in Combination of Two for Temporomandibular Joint Disc Tissue Engineering.” Arch. Oral Biol. 51.3(2006):215-221.Applicant
- Alsberg et al. “Cell-Interactive Alginate Hydrogels for Bone Tissue Engineering.” J. Dent. Res. 80.11(2001):2025-2029.Applicant
- Alsberg et al. “Engineering Growing Tissues.” PNAS. 99.18(2002):12025-12030.Applicant
- Alsberg et al. “Regulating Bone Formation via Controlled Scaffold Design.” J. Dent. Res. 82.11(2003):903-908.Applicant
- Anderson et al. “Biomaterial Microarrays: Rapid, Microscale Screening of Polymer-Cell Interaction.” Biomaterials. 26.23(2005):4892-4897.Applicant
- Anderson et al. “Nanoliter-Scale Synthesis of Arrayed Biomaterials and Application to Human Embryonic Stem Cells.” Nat. Biotechnol. 22.7(2004):863-866.Applicant
- Anderson et al. “The NOD Mouse: A Model of Immune Dysregulation.” Annu. Rev. Immunol. 23(2005):447-485.Applicant
- Anderson. “A Role for Nitric Oxide in Muscle Repair: Nitric Oxide-Mediated Activation of Muscle Satellite Cells.” Mol. Biol. Cell. 11(2000):1859-1874.Applicant
- Arany et al. “At the Edge of Translation—Materials to Program Cells for Directed Differentiation.” Oral Dis. 17.3(2011):241-251.Applicant
- Atala et al. “Endoscopic Treatment of Vesicoureteral Reflux with a Chondrocyte-Alginate Suspension.” J. Urol. 152(1994):641-643.Applicant
- Augst et al. “Alginate Hydrogels as Biomaterials.” Macromol. Biosci. 6(2006):623-633.Applicant
- Bachelder et al. “Acid-Degradable Polyurethane Particles for Protein-Based Vaccines: Biological Evaluation and in Vitro Analysis of Particle Degradation Products.” Mol. Pharm. 5.5(2008):876-884.Applicant
- Bachem et al. “Superior Antigen Cross-Presentation and XCR1 Expression Define Human CD11c+CD141+ Cells as Homologues of Mouse CD8+ Dendritic Cells.” J. Exp. Med. 207.6(2010):1273-1281.Applicant
- Badovinac et al. “Regulation of CD8 T+ Cells Undergoing Primary and Secondary Responses to Infection in the Same Host.” J. Immunol. 170(2003):4933-4942.Applicant
- Bakri et al. “Pharmacokinetics of Intravitreal Bevacizumab (Avastin).” Ophthalmology. 114.5(2007):855-859.Applicant
- Balakrishna et al. “Structural Correlates of Antibacterial and Membrane-Permeabilizing Activities in Acylpolyamines.” Antimicrob. Agents Chemother. 50.3(2006):852-861.Applicant
- Banchereau et al. “Dendritic Cells and the Control of Immunity.” Nature. 392.6673(1998):245-252.Applicant
- Bar-Cohen et al. “Electroactive Polymer Actuators and Sensors.” MRS Bullet. 33.3(2008):173-181.Applicant
- Bar-Or et al. “Induction of Antigen-Specific Tolerance in Multiple Sclerosis after Immunization with DNA Encoding Myelin Basic Protein in a Randomized, Placebo-Controlled Phase ½ Trial.” Arch. Neurol. 64.10(2007):1407-1415.Applicant
- Barbero et al. “Growth Factor Supplemented Matrigel Improves Ectopic Skeletal Muscle Formation—A Cell Therapy Approach.” J. Cell. Physiol. 186(2001):183-192.Applicant
- Barrio et al. “A Two-Dimensional Numerical Study of Spatial Pattern Formation in Interacting Turing Systems.” Bull. Math. Biol. 61.3(1999):483-505.Applicant
- Bates. “Improved Muscle Regeneration by Combining VEGF With IGF1.” Regen. Med. 5.6(2010):853-854.Applicant
- Beaucage et al. “The Functionalization of Oligonucleotides via Phosphoramidite Derivatives.” Tetrahedron. 49.10(1993):1925-1963.Applicant
- Beauchamp et al. “Dynamics of Myoblast Transplantation Reveal a Discrete Minority of Precursors with Stem Cell-Like Properties as the Myogenic Source.” J. Cell Biol. 144.6(1999):1113-1122.Applicant
- Beebe et al. “Functional Hydrogel Structures for Autonomous Flow Control Inside Microfluidic Channels.” Nature. 404(2000):588-590.Applicant
- Bekiari et al. “Study of Poly(N,N-dimethylacrylamide)/CdS Nanocomposite Organic/Inorganic Gels.” Langmuir. 20.19(2004):7972-7975.Applicant
- Bischoff. “Proliferation of Muscle Satellite Cells on Intact Myofibers in Culture.” Dev. Biol. 115.1(1986):129-139.Applicant
- Blanas et al. “Induction of Autoimmune Diabetes by Oral Administration of Autoantigen.” Science. 274.5293(1996):1707-1709.Applicant
- Blumenthal et al. “Polyurethane Scaffolds Seeded with Genetically Engineered Skeletal Myoblasts: A Promising Tool to Regenerate Myocardial Function.” Artificial Organs. 34.2(2010):E46-E54.Applicant
- Bohl et al. “Role of Synthetic Extracellular Matrix in Development of Engineered Dental Pulp.” J. Biomater. Sci. Polym. Ed. 9.7(1998):749-764.Applicant
- Bonauer et al. “MicroRNA-92a Controls Angiogenesis and Functional Recovery of Ischemic Tissues in Mice.” Science. 324.5935(2009):1710-1713.Applicant
- Boontheekul et al. “Controlling Alginate Gel Degradation Utilizing Partial Oxidation and Bimodal Molecular Weight Distribution.” Biomaterials. 26.15(2005):2455-2465.Applicant
- Boontheekul et al. “Regulating Myoblast Phenotype Through Controlled Gel Stiffness and Degradation.” Tissue Engin. 13.7(2007):1431-1442.Applicant
- Borselli et al. “Functional Muscle Regeneration with Combined Delivery of Angiogenesis and Myogenesis Factors.” PNAS. 107.8(2010):3287-3292.Applicant
- Bouhadir et al. “Degradation of Partially Oxidized Alginate and its Potential Application for Tissue Engineering.” Biotechnol. Prog. 17.5(2001):945-950.Applicant
- Bouhadir et al. “Synthesis of Cross-Linked Poly(aldehyde guluronate) Hydrogels.” Polymer. 40(1999):3575-3584.Applicant
- Bowne et al. “Injection of DNA Encoding Granulocyte-Macrophage Colony-Stimulating Factor Recruits Dendritic Cells for Immune Adjuvant Effects.” Cytokines Cell Mol. Ther. 5.4(1999):217-225.Applicant
- Brinkman et al. “Photo-Cross Linking of Type 1 Collagen Gels in the Presence of Smooth Muscle Cells: Mechanical Properties, Cell Viability, and Function.” Biomacromolecules. 4.4(2003):890-895.Applicant
- Brinkmann et al. “Neutrophil Extracellular Traps Kill Bacteria.” Science. 303.5663(2004):1532-1535.Applicant
- Brouwers et al. “Can the Growth Factors PTHrP, Ihh and VEGF, Together Regulate the Development of a Long Bone?” J. Biomech. 39.15(2006):2774-2782.Applicant
- Bryant et al. “Photo-Patterning of Porous Hydrogels for Tissue Engineering.” Biomater. 28.19(2007):2978-2986.Applicant
- Burdick et al. “Stimulation of Neurite Outgrowth by Neurotrophins Delivered From Degradable Hydrogels.” Biomater. 27.3(2006):452-459.Applicant
- Calvert. “Electroactive Polymer Gels.” Electroactive Polymer (EAP) Acutators as Artificial Muscle: Reality, Potential, and Challenges. Bar-Cohen, ed. Bellingham, WA: Spie Press. (2004):151-170.Applicant
- Calvert. “Gel Sensors and Actuators.” MRS Bullet. 33.3(2008):207-212.Applicant
- Cao et al. “Promoting Angiogenesis via Manipulation of VEGF Responsiveness with Notch Signaling.” Biomater. 30.25(2009):4085-4093.Applicant
- Carlson et al. “Notch Signaling Pathway and Tissue Engineering.” Front. Biosci. 12(2007):5143-5156.Applicant
- Carmeliet et al. “Angiogenesis in Cancer and Other Diseases.” Nature. 407.6801(2000):249257.Applicant
- Carmeliet. “Mechanisms of Angiogenesis and Arteriogenesis.” Nat. Med. 6.3(2000):389-395.Applicant
- Chan et al. “Antifibrotic Effects of Suramin in Injured Skeletal Muscle After Laceration.” J. Appl. Physiol. 95(2003):771-780.Applicant
- Chan et al. “Helix Induction in Antimicrobial Peptides by Alginate in Biofilms.” J. Biol. Chem. 279.37(2004):38749-38754.Applicant
- Chen et al. “Adipogenic Differentiation of Adipose Tissue-Derived Human Mesenchymal Stem Cells: Effects of Gastric Bypass Surgery.” Surg. Endosc. 26(2012):3449-3456.Applicant
- Chen et al. “Integrated Approach to Designing Growth Factor Delivery Systems.” FASEB J. 21.14(2007):3896-3903.Applicant
- Chen et al. “Polymeric Growth Factor Delivery Strategies for Tissue Engineering.” Pharm. Res. 20.8(2003):1103-1112.Applicant
- Chen et al. “Skeletal Muscle Stem Cells.” Reprod. Biol. Endocrinol. 1(2003):101.Applicant
- Chen et al. “Spatio-Temporal VEGF and PDGF Delivery Patterns Blood Vessel Formation and Maturation.” Pharm. Res. 24.2(2007):258-264.Applicant
- Choi et al. “In Vitro Mineralization by Preosteoblasts in Poly(DL-lactide-co-glycolide) Inverse Opal Scaffolds Reinforced with Hydrozyapatite Nanoparticles.” Langmuir. 26.14(2010):12126-12131.Applicant
- Choi et al. “Three-Dimentional Scaffolds for Tissue Engineering: The Importance of Uniformity in Pore Size and Structure.” Langmuir. 26.24(2010):19001-19006.Applicant
- Choi. “Replacement Organs, Hot Off the Press.” New Scientist. 177.2379(2003):16.Applicant
- Chou et al. “Characterization of Photocross Linked Alginate Hydrogels for Nucleus Pulposus Cell Encapsulation.” J. Biomed. Mater. Res. A. 91A.1(2009):187-194.Applicant
- Chromiak et al. “Bioreactor Perfusion System for the Long-Term Maintenance of Tissue-Engingeered Skeletal Muscle Organoids.” In Vitro Cell Dev. Biol. Anim. 34.9(1998):694-703.Applicant
- Clauss et al. “Interstitial Transport of Rabbit and Sheep Antibodies in Normal and Neoplastic Tissues.” Cancer Res. 50.12(1990):3487-3492.Applicant
- Cohen et al. “Controlled Delivery Systems for Proteins Based on Poly(Lactic/Glycolic Acid) Microspheres.” Pharm. Res. 8.6(1991):713-720.Applicant
- Comisar et al. “Engineering RGD Nanopatterned Hydrogels to Control Preosteoblast Behavior: A Combined Computational and Experimental Approach.” Biomaterials. 28(2007):4409-4417.Applicant
- Conboy et al. “The Regulation of Notch Signaling Controls Satellite Cell Activation and Cell Fate Determination in Postnatal Myogenesis.” Dev. Cell. 3.3(2002):397-409.Applicant
- Conconi et al. “In vitro and in vivo Evaluation of Acellular Diaphragmatic Matrices Seeded with Muscle Precursors Cells and Coated with VEGF Silica Gel to Repair Muscle Defect of the Diaphragm.” J. Biomed. Mater. Res. 89A.2(2009):304-316.Applicant
- Conn et al. “Purification of a Glycoprotein Vascular Endothelial Cell Mitogen From a Rat Glioma-Derived Cell Line.” PNAS. 87.4(1990):1323-1327.Applicant
- Cooper et al. “Extended Amplification In Vitro and Replicative Senescence: Key Factors Implicated in the Success of Human Myoblast Transplantation.” Hum. Gene Ther. 14(2003):1169-1179.Applicant
- Cornelison et al. “Single-Cell Analysis of Regulatory Gene Expression in Quiescent and Activated Mouse Skeletal Muscle Satellite Cells.” Dev. Biol. 191.2(1997):270-283.Applicant
- Cornelison et al. “Syndecan-3 and Syndecan-4 Specifically Mark Skeletal Muscle Satellite Cells and Are Implicated in Satellite Cell Maintenance and Muscle Regeneration.” Dev. Biol. 239.1(2001):79-94.Applicant
- Coulson et al. “Flow of Fluids through Granular Beds and Packed Columns.” Chemical Engineering. New York: Pergamon Press. 2(1978):125-171.Applicant
- Crameri et al. “Improved Green Fluorescent Protein by Molecular Evolution Using DNA Shuffling.” Nat. Biotechnol. 14.3(1996):315-319.Applicant
- Cullen et al. “Investigation of Vascular Endothelial Growth Factor Effects on Pulmonary Endothelial Monolayer Permeability and Neutrophil Transmigration.” Gen. Pharmacol. 35.3(2000):149-157.Applicant
- Curiel et al. “Tumor Immunotherapy: Inching Toward the Finish Line.” J. Clin. Invest. 109.3(2002):311-312.Applicant
- D'Amico et al. “The Early Progenitors of Mouse Dendritic Cells and Plasmacytoid Predendritic Cells are within the Bone Marrow Hemopoietic Precursors Expressing Flt3.” J. Exp. Med. 198.2(2003):293-303.Applicant
- Dar et al. “Optimization of Cardiac Cell Seeding and Distribution in 3D Porous Alginate Scaffolds.” Biotechnol. Bioeng. 80(2002):305-312.Applicant
- Daro et al. “Polyethylene Glycomodified GM-CSF Expands CD11bhighCD11chigh but not CD11blowCD11chigh Murine Dendritic Cells In Vivo: A Comparative Analysis with Flt3 Ligand.” J. Immunol. 165.1(2000):49-58.Applicant
- De Temmerman et al. “Particulate Vaccines: On the Quest for Optimal Delivery and Immune Response.” Drug Disc. Today. 16.13/14(2011):569-582.Applicant
- den Haan et al. “CD8+ by not CD8− Dendritic Cells Cross-Prime Cytotoxic T Cells In Vivo.” J. Exp. Med. 192.12(2000):1685-1696.Applicant
- Dennis et al. “Excitability and Contractility of Skeletal Muscle Engineered From Primary Cultures and Cell Lines.” Am. J. Physiol. Cell Physiol. 280(2001):C288-C295.Applicant
- Dennis et al. “Excitability and Isometric Contractile Properties of Mammalian Skeletal Muscle Constructs Engineered in vitro.” In Vitro Cell Dev. Biol. Anim. 36.5(2000):327-335.Applicant
- Dieu et al. “Selective Recruitment of Immature and Mature Dendritic Cells by Distinct Chemokines Expressed in Different Anatomic Sites.” J. Exp. Med. 188.2(1988):373-386.Applicant
- Doan et al. “Subcellular Localization of a Sporulation Membrane Protein is Achieved Through a Network of Interactions Along and Across the Septum.” Mol. Microbiol. 55.6(2005):1767-1781.Applicant
- Dor et al. “Making Vascular Networks in the Adult: Branching Morphogenesis Without a Roadmap.” Trends Cell Biol. 13.3(2003):131-136.Applicant
- Dranoff et al. “Vaccination with Irradiated Tumor Cells Engineered to Secrete Murine Granulocyte-Macrophage Colony-Stimulating Factor Stimulates Potent, Specific and Long-Lasting Anti-Tumor Immunity.” PNAS. 90.8(1993):3539-3543.Applicant
- Dranoff. “Cyotkines in Cancer Pathogenesis and Cancer Therapy.” Nat. Rev. Cancer. 4.1(2004):11-22.Applicant
- Dudley et al. “Adoptive Cell Transfer Therapy Following Non-Myeloablative by Lymphodepleting Chemotherapy for the Treatment of Patients with Refractory Metastatic Melanoma.” J. Clin. Oncol. 23.10(2005):2346-2357.Applicant
- Egholm et al. “Peptide Nucleic Acids (PNA). Oligonucleotide Analogues with an Achiral Peptide Backbone.” J. Am. Chem. Soc. 114.5(1992):1895-1897.Applicant
- Egholm et al. “PNA Hybridizes to Complementary Oligonucleotides Obeying the Watson-Crick Hydrogen-Bonding Rules.” Nature. 365.6446(1993):566-568.Applicant
- Ehrbar et al. “Endothelial Cell Proliferation and Progenitor Maturation by Fibrin-Bound VEGF Variants with Differential Susceptibilities to Local Cellular Activity.” J. Control. Release. 101(2004):93-109.Applicant
- Eiselt et al. “Porous Carriers for Biomedical Applications Based on Alginate Hydrogels.” Biomat. 21.19(2000):1921-1927.Applicant
- El-Backly et al. “Regeneration of Dentine/Pulp-Like Tissue Using a Dental Pulp Stem Cell/Poly(Lactic-Co-Glycolic) Acid Scaffold Construct in New Zealand White Rabbits.” Aust. Endod. J. 34.2(2008):52-67.Applicant
- Eldar et al. “Elucidating Mechanisms Underlying Robustness of Morphogen Gradients.” Curr. Opin. Genet. Dev. 14.4(2004):435-439.Applicant
- Eldar et al. “Robustness of the BMP Morphogen Gradient in Drosophila Embryonic Patterning.” Nature. 419.6904(2002):304-308.Applicant
- Eldar et al. “Self-Enhanced Ligand Degradation Underlies Robustness of Morphogen Gradients.” Dev. Cell. 5.4(2003):635-646.Applicant
- Engler et al. “Matrix Elasticity Directs Stem Cell Lingeage Specification.” Cell. 126.4(2006):677-689.Applicant
- Ennett et al. “Temporally Regulated Delivery of VEGF in vitro and in vivo.” J. Biomed. Mater. Res. A. 79.1(2006):176-184.Applicant
- Faissner et al. “Boundaries and Inhibitory Molecules in Developing Neural Tissues.” Glia. 13.4(1995):233-254.Applicant
- Falsey et al. “Peptide and Small Molecule Microarray for High Throughput Cell Adhesion and Functional Assays.” Bioconjug. Chem. 12.3(2001):346-353.Applicant
- Farrar et al. “T Helper Subset Development: Roles of Instruction, Selection, and Transcription.” J. Clin. Invest. 109.4(2002):431-435.Applicant
- Ferrara et al. “Angiogenesis as a Therapeutic Target.” Nature. 438.7070(2005):967-974.Applicant
- Ferrara et al. “Discovery and Development of Bevacizumab, an Anti-VEGF Antibody for Treating Cancer.” Nat. Rev. Drug Discov. 3.5(2004):391-400.Applicant
- Fischer et al. “A Brilliant Monomeric Red Fluorescent Protein to Visualize Cytoskeleton Dynamics in Dictyostelium.” FEBS Lett. 577.1-2(2004):227-232.Applicant
- Fischer et al. “Visualizing Cytoskeleton Dynamics in Mammalian Cells Using a Humanized Variant of Monomeric Red Fluorescent Protein.” FEBS Lett. 580.10(2006):2495-2502.Applicant
- Folkman. “Angiogenesis.” Annu. Rev. Med. 57(2006):1-18.Applicant
- Fonseca et al. “Capitalizing on the Immunogenicity of Dying Tumor Cells.” Clin. Cancer Res. 14.16(2008):1603-1608.Applicant
- Fontaine et al. “Surgical Treatment of Peripheral Circulation Disorders.” Helv. Chir. Acta. 21.56(1954):499-533. (German Original, No English Translation Available).Applicant
- Fox. “Management of Worsening Multiple Sclerosis with Mitoxantrone: A Review.” Clin. Ther. 28.4(2006):461-474.Applicant
- Friedrich et al. “Promoter Traps in Embryonic Stem Cells: A Genetic Screen to Identify and Mutate Developmental Genes in Mice.” Genes Dev. 5(1991):1513-1523.Applicant
- Fukushima et al. “The Use of an Antifibrosis Agent to Improve Muscle Recovery After Laceration.” Am. J. Sports Med. 29.4(2001):394-402.Applicant
- Gamvrellis et al. “Vaccines that Facilitate Antigen Entry into Dendritic Cells.” Immunol. Cell Biol. 82(2004):506-516.Applicant
- GenBank Accession No. A32848.1, Jul. 5, 2002.Applicant
- GenBank Accession No. AAA35789.1, Apr. 27, 1993.Applicant
- GenBank Accession No. AAA56738.1, Dec. 7, 1994.Applicant
- GenBank Accession No. AAA60552.1, Nov. 24, 2003.Applicant
- GenBank Accession No. AAA64297.1, Mar. 24, 1995.Applicant
- GenBank Accession No. AAB21432.2, Jun. 5, 2000.Applicant
- GenBank Accession No. AAB29057.2, Mar. 6, 2001.Applicant
- GenBank Accession No. AAB31818.1, Jan. 25, 1995.Applicant
- GenBank Accession No. AAC16450.1, May 15, 1998.Applicant
- GenBank Accession No. AAH07789.1, Jun. 9, 2008.Applicant
- GenBank Accession No. AAH20698.1, Jul. 15, 2006.Applicant
- GenBank Accession No. AAH32517.2, Jun. 9, 2008.Applicant
- GenBank Accession No. AAH93731.1, Jul. 17, 2006.Applicant
- GenBank Accession No. AAI44040, Mar. 18, 2009.Applicant
- GenBank Accession No. ABC86910, Jan. 3, 2011.Applicant
- GenBank Accession No. CAA01954.1, Jun. 15, 1995.Applicant
- GenBank Accession No. CAA40093.1, Oct. 7, 2008.Applicant
- GenBank Accession No. CAA62632.1, Sep. 15, 1995.Applicant
- GenBank Accession No. CAG29322.1, Oct. 16, 2008.Applicant
- GenBank Accession No. CAG33149.1, Oct. 21, 2008.Applicant
- GenBank Accession No. CAG46721.1, Jun. 29, 2004.Applicant
- GenBank Accession No. CBI71013.1, Feb. 2, 2010.Applicant
- GenBank Accession No. EF064765.1, Nov. 13, 2006.Applicant
- GenBank Accession No. EU826563.1, Jul. 23, 2008.Applicant
- GenBank Accession No. NM_000230.2, Dec. 17, 2012.Applicant
- GenBank Accession No. NM_000514.3, Aug. 19, 2012.Applicant
- GenBank Accession No. NM_000601.4, Nov. 25, 2012.Applicant
- GenBank Accession No. NM_000614.3, Sep. 9, 2012.Applicant
- GenBank Accession No. NM_000660.4, Dec. 9, 2012.Applicant
- GenBank Accession No. NM_000800.3, Mar. 4, 2012.Applicant
- GenBank Accession No. NM_001102654.1, Dec. 16, 2012.Applicant
- GenBank Accession No. NM_001111283.1, Dec. 9, 2012.Applicant
- GenBank Accession No. NM_001171630.1, Dec. 9, 2012.Applicant
- GenBank Accession No. NM_001202.3, Nov. 18, 2012.Applicant
- GenBank Accession No. NM_002506.2, Dec. 9, 2012.Applicant
- GenBank Accession No. NM_002632.4, May 4, 2011.Applicant
- GenBank Accession No. NM_003236.2, Aug. 21, 2011.Applicant
- GenBank Accession No. NM_003263.3, Jan. 5, 2013.Applicant
- GenBank Accession No. NM_003264.3, Jan. 6, 2013.Applicant
- GenBank Accession No. NM_003268.5, Nov. 25, 2012.Applicant
- GenBank Accession No. NM_006068.4, Oct. 28, 2012.Applicant
- GenBank Accession No. NM_016562.3, Jan. 6, 2013.Applicant
- GenBank Accession No. NM_030956.3, Oct. 28, 2012.Applicant
- GenBank Accession No. NM_033023.4, Nov. 18, 2012.Applicant
- GenBank Accession No. NM_138554.4, Dec. 29, 2012.Applicant
- GenBank Accession No. NM_138636.4, Dec. 23, 2012.Applicant
- GenBank Accession No. NM_170731.4, Dec. 9, 2012.Applicant
- GenBank Accession No. NM_205819.3, Dec. 6, 2012.Applicant
- GenBank Accession No. NM_205820.1, Jan. 5, 2013.Applicant
- GenBank Accession No. NM_205823.2, Jan. 6, 2013.Applicant
- GenBank Accession No. NP_001096124.1, Dec. 16, 2012.Applicant
- GenBank Accession No. NP_002010.2, Dec. 9, 2012.Applicant
- GenBank Accession No. NP_003254.2, Jan. 5, 2013.Applicant
- GenBank Accession No. NP_003255.2, Jan. 6, 2013.Applicant
- GenBank Accession No. NP_003259.2, Nov. 25, 2012.Applicant
- GenBank Accession No. NP_006059.2, Oct. 28, 2012.Applicant
- GenBank Accession No. NP_057646.1, Jan. 6, 2013.Applicant
- GenBank Accession No. NP_112218.2, Oct. 28, 2012.Applicant
- GenBank Accession No. NP_570912.2, Nov. 18, 2012.Applicant
- GenBank Accession No. NP_612564.1, Dec. 29, 2012.Applicant
- GenBank Accession No. NP_619542.1, Dec. 23, 2012.Applicant
- GenBank Accession No. NP_991388.2, Dec. 6, 2012.Applicant
- GenBank Accession No. NP_991389.1, Jan. 5, 2013.Applicant
- GenBank Accession No. NP_991392.1, Jan. 6, 2013.Applicant
- GenBank Accession No. P49771.1, Jan. 9, 2013.Applicant
- Gerhardt et al. “VEGF Guides Angiogenic Sprouting Utilizing Endothelial Tip Cell Filopodia.” J. Cell Biol. 161.6(2003):1163-1177.Applicant
- Gilboa. “Dendritic-Cell Based Cancer Vaccines.” J. Clin. Invest. 117.5(2007):1195-1203.Applicant
- Glasbey et al. “Image Analysis and Three-Dimensional Modelling of Pores in Soil Aggregates.” Eur. J. Soil Sci. 42.2(1991):479-486.Applicant
- Gnjatic et al. “Toll-Like Receptor Agonists: Are They Good Adjuvants?” Cancer J. 16.4(2010):382-391.Applicant
- Godbey et al. “Size Matters: Molecular Weight Affects the Efficiency of Poly(ethylenimine) as a Gene Delivery Vehicle.” J. Biomed. Mater. Res. 45.3(1999):268-275.Applicant
- Godbey et al. “Tracking the Intracellular Path of Poly(ethylenimine)/DNA Complexes for Gene Delivery.” PNAS. 96.9(1999):5177-5181.Applicant
- Gospodarowicz et al. “Effect of Fibroblast Growth Factor on the Division and Fusion of Bovine Myoblasts.” J. Cell Biol. 70.2(1976):395-405.Applicant
- Griffith et al. “Tissue Engineering—Current Challenges and Expanding Opportunities.” Science. 295(2002):1009-1014.Applicant
- Grimmer et al. “Tracheal Reconstruction Using Tissue-Engineered Cartilage.” Arch. Otolaryngot Head Neck Surg.130.10(2004):1191-1196.Applicant
- Gros et al. “A Common Somitic Origin for Embryonic Muscle Progenitors and Satellite Cells.” Nature. 435(2005):954-958.Applicant
- Gullberg et al. “Extracellular Matrix and Its Receptors During Development.” Int. J. Dev. Biol. 39(1995):845-854.Applicant
- Gupta et al. “Magnetically Controlled Targeted Micro-Carrier Systems.” Life Sci. 44.3(1989):175-186.Applicant
- Gussoni et al. “Dystophin Expression and in the mdx Mouse Restored by Stem Cell Transplantation.” Nature. 401(1999):390-394.Applicant
- Hamby et al. “Small Molecule Inhibitors of Tumor-Promoted Angiogenesis, Including Protein Tyrosine Kinase Inhibitors.” Pharmacol. Ther. 82.2-3(1999):169-193.Applicant
- Hamdy et al. “Targeting Dendritic Cells with Nano-Particulate PLGA Cancer Vaccine Formulations.” Adv. Drug Deliv. Rev. 63.10(2011):943-955.Applicant
- Hamilton et al. “GM-CSF Biology.” Growth Factors. 22.4(2004):225-231.Applicant
- Hamilton. “GM-CSF in Inflammation and Autoimmunity.” Trends Immunol. 23.8(2002):403-408.Applicant
- Hanada. “Efficacy of Rehabilitative Therapy in Regional Musculoskeletal Conditions.” Best Pract. Res. Clin. Rheumatol. 17.1(2003):151-166.Applicant
- Hansen et al. “Comparison of Clinical Grade Type 1 Polarized and Standard Matured Dendritic Cells for Cancer Immunotherapy.” Vaccine. 31.4(2013):639-646.Applicant
- Hansen et al. “Integrin Binding and Cell Spreading on Extracellular Matrix Act at Different Points in the Cell Cycle to Promote Hepatocyte Growth.” Mol. Biol. Cell. 5(1994):967-975.Applicant
- Harris et al. “Open Pore Biodegradable Matrices Formed with Gas Foaming.” J. Biomed. Mater. Res. 42.3(1998):396-402.Applicant
- Harrison. “What is the Status of Reaction-Diffusion Theory Thirty-Four Years After Turing?” J. Theor. Biol. 125.4(1987):369-384.Applicant
- Hartgerink et al. “Peptide-Amphiphile Nanofibers: A Versatile Scaffold for the Preparation of Self-Assembling Materials.” PNAS. 99.8(2002):5133-5138.Applicant
- Hartmann et al. “CpG DNA: A Potent Signal for Growth, Activation, and Maturation of Human Dendritic Cells.” PNAS. 96(1999):9305-9310.Applicant
- Hashimoto et al. “Development of Alginate Wound Dressings Linked with Hybrid Peptides Derived from Laminin and Elastin.” Biomaterials. 25.7-8(2004):1407-1414.Applicant
- Hawke et al. “Myogenic Satellite Cells: Physiology to Molecular Biology.” J. Appl. Physiol. 91(2001):534-551.Applicant
- Heath. “Cells for Tissue Engineering.” Trends Biotechnol. 18.1(2006):17-19.Applicant
- Helm et al. “Synergy Between Interstitial Flow and VEGF Directs Capillary Morphogenesis in vitro Through a Gradient Amplification Mechanism.” PNAS. 102.44(2005):15779-15784.Applicant
- Henry et al. “The VIVA Trial: Vascular Endothelial Growth Factor in Ischemia for Vascular Angiogenesis.” Circulation. 107.10(2003):1359-1365.Applicant
- Hermanson. Bioconjugate Techniques. New York: Academic Press. (1996):152-185.Applicant
- Heslop et al. “Transplanted Primary Neonatal Myoblasts can Give Rise to Functional Satellite Cells as Identified Using the Myf5nlacZI+ Mouse.” Gene Ther. 8(2001):778-783.Applicant
- Hildner et al. “Batf3 Deficiency Reveals a Critical Role for CD8α+ Dendritic Cells in Cytotoxic T Cell Immunity.” Science. 322.5904(2008):1097-1100.Applicant
- Hill et al. “Designing Scaffolds to Enhance Transplanted Myoblast Survival and Migration.” Tissue Engin. 12.5(2006):1295-1304.Applicant
- Hill et al. “Muscle Satellite (Stem) Cell Activation During Local Tissue Injury and Repair.” J. Anat. 203.1(2003):89-99.Applicant
- Hill. “Macroporous Scaffold Architecture, Peptide, HGF/FGF and Myoblast Incorporation Enhance Myogenesis.” IADR/AADR/CADR 83rd General Session. (Mar. 9-12, 2005). Poster #2829.Applicant
- Hirano et al. “Peptide and Protein Presenting Materials for Tissue Engineering.” Adv. Mat. 16.1(2004):17-25.Applicant
- Hodge-Dufour et al. “Inhibition of Interferon γ Induced Interleukin 12 Production: A Potential Mechanism for the Anti-Inflammatory Activities of Tumor Necrosis Factor.” PNAS. 95.23(1998):13806-13811.Applicant
- Hodi et al. “Immunologic and Clinical Effects of Antibody Blockade of Cytotoxic T Lymphocyte-Associated Antigen 4 in Previously Vaccinated Cancer Patients.” PNAS. 105.8(2008):3005-3010.Applicant
- Horsley et al. “Il-4 Acts as a Myoblast Recruitment Factor During Mammalian Muscle Growth.” Cell. 113.4(2003):483-494.Applicant
- Hsiong et al. “Differentiation Stage Alters Matrix Control of Stem Cells.” J. Biomed. Mater. Res. Part A. 8(2007):145-156.Applicant
- Huang et al. “Fabrication and in vitro Testing of Polymeric Delivery Systems for Condensed DNA.” J. Biomed. Mater. Res. 67(2003):1384-1392.Applicant
- Huang et al. “Long-Term in Vivo Gene Expression via Delivery of PEI-DNA Condensates From Porous Polymer Scaffolds.” Hum. Gene Ther. 16.5(2005):609-617.Applicant
- Hubbell et al. “Materials Engineering for Immunomodulation.” Nature. 462(2009):449-460.Applicant
- Hubbell. “Biomaterials in Tissue Engineering.” Bio/Tech. 13(1995):565-576.Applicant
- Huebsch et al. “Harnessing Traction-Mediated Manipulation of the Cell/Matrix Interface to Control Stem-Cell Fate.” Nat. Mater. 9.6(2010):518-526.Applicant
- Hwang et al. “Fabrication of Three-Dimensional Porous Cell-Laden Hydrogel for Tissue Engineering.” Biofabrication. 2.3(2010):035003.Applicant
- Ishihara et al. “Roles of Bradykinin in Vascular Permeability and Angiogenesis in Solid Tumor.” Int. Immunopharmacol. 2.4(2002):499-509.Applicant
- Iwamoto et al. “Preparation of an Ionic Polymer Gel Microactuator and Measurement of its Periodic Motions.” Nippon Kagaku Kaishi. 9(1997):609-614. (Japanese Original and English Abstract).Applicant
- Jain. “Molecular Regulation of Vessel Maturation.” Nat. Med. 9.6(2003):685-693.Applicant
- Jain. “The Manufacturing Techniques of Various Drug Loaded Biodegradable Poly(lactide-co-glycolide) (PLGA) Devices.” Biomater. 21.23(2000):2475-2490.Applicant
- Jankovic et al. “In the Absence of IL-12, CD4+ T Cell Responses to Intracellular Pathogens Fail to Default to a Th2 Pattern and are Host Protective in an IL-10−/− Setting.” Immunity. 16.3(2002):429-439.Applicant
- Jego et al. “Plasmacytoid Dendritic Cells Induce Plasma Cell Differenetiation Through Type I Interferon and Interleukin 6.” Immunity. 19.2(2003):225-234.Applicant
- Jiang et al. “Self-Organization of Periodic Patterns by Dissociated Feather Mesenchymal Cells and the Regulation of Size, Number and Spacing of Primordia.” Development. 126.22(1999):4997-5009.Applicant
- Jinushi et al. “Enhancing the Clinical Activity of Granulocyte-Macrophage Colony-Stimulating Factor-Secreting Tumor Cell Vaccines.” Immunol. Rev. 222(2008):287-298.Applicant
- Jinushi et al. “MFG-E8-Mediated Uptake of Apoptotic Cells by APCs Links the Pro- and Antiinflammatory Activities of GM-CSF.” J. Clin. Invest. 117.7(2007):1902-1913.Applicant
- Johnson et al. “Activation of Skeletal Muscle Satellite Cells and the Role of Fibroblast Growth Factor Receptors.” Exp. Cell Res. 219.2(1995):449-453.Applicant
- Juntanon et al. “Electrically Controlled Release of Sulfosalicylic Acid from Crosslinked Poly(Vinyl Alcohol) Hydrogel.” Int. J. Pharm. 356(2008):1-11.Applicant
- Kanzler et al. “Therapeutic Targeting of Innate Immunity with Toll-Like Receptor Agaonists and Antagonists.” Nat. Med. 13.5(2007):552-559.Applicant
- Kawai et al. “Innate Immune Recognition of Viral Infection.” Nat. Immunol. 7.2(2006):131-137.Applicant
- Kawashima et al. “Pulmonary Delivery of Insulin With Nebulized DL-Lactide/Glycolide Copolymer (PLGA) Nanospheres to Prolong Hypoglycemic Effect.” J. Control. Release. 62.1-2(1999):279-287.Applicant
- Khownium et al. “Novel Endotoxin-Compounds with Terephthalaldehyde-bis-guanyllhydrazone Scaffolds.” Bioorg. Med. Chem. Lett. 16(2006):1305-1308.Applicant
- Kim et al. “An Overview of Cartilage Tissue Engineering.” Yonsei Med. J. 41.6(2000):766-773.Applicant
- Kim et al. “Multifunctional Capsule-in-Capsules for Immunoprotection and Trimodal Imaging.” Angew. Chem. Int. Ed. 50.10(2011):2317-2321.Applicant
- Kim et al. “The Effect of VEGF on the Myogenic Differentiation of Adipose Tissue Derived Stem Cells Within Thermosensitive Hydrogel Matrices.” Biomaterials. 31.6(2010):1213-1218.Applicant
- Kinoshita et al. “Successive Injections in MDX Mice of Myoblasts Grown with bFGF.” Neuromusc. Disord. 6.3(1996):187-193.Applicant
- Kisak et al. “The Vesosome—A Multicompartment Drug Delivery Vehicle.” Curr. Med. Chem. 11.2(2004):199-219.Applicant
- Klebanoff et al. “CD8+ T-Cell Memory in Tumor Immunology and Immunotherapy.” Immunol. Rev. 211(2006):214-224.Applicant
- Klinman. “Immunotherapeutic Uses of CpG Oligodeoxynucleotides.” Nat. Rev. Immunol. 4.4(2004):249-258.Applicant
- Kondo et al. “A Reaction-Diffusion Wave on the Skin of the Marine Angelfish Pomacanthus.” Nature. 376(2002):765-768.Applicant
- Kong et al. “Controlling Degradation of Hydrogels via the Size of Crosslinked Junctions.” Adv. Mater. 16.21(2004):1917-1921.Applicant
- Kong et al. “Controlling Rigidity and Degradation of Alginate Hydrogels via Molecular Weight Distribution.” Biomacromolec. 5.5(2004):1720-1727.Applicant
- Kong et al. “Decoupling the Dependence of Rheological/Mechanical Properties of Hydrogels from Solids Concentration.” Polymer. 43(2002):6239-6246.Applicant
- Kong et al. “Design of Biodegradable Hydrogel for the Local and Sustained Delivery of Angiogenic Plasmid DNA.” Pharma. Res. 25.5(2008):1230-1238.Applicant
- Kong et al. “Designing Alginate Hydrogels to Maintain Viability of Immobilized Cells.” Biomat. 24.22(2003):4023-4029.Applicant
- Kong et al. “Non-Viral Gene Delivery Regulated by Stiffness of Cell Adhesion Substrates.” Nat. Mater. 4(2005):460-465.Applicant
- Krieg. “Development of TLR9 Agonists for Cancer Therapy.” J. Clin. Invest. 117.5(2007):1184-1194.Applicant
- Krishnamachari et al. “PLGA Microparticles that Co-Deliver Antigen and Toll Like Receptor Ligand Adjuvants for Applications in Cancer Immunotherapy.” AAPS Pharmaceutica. Nov. 11, 2009. Web. Mar. 1, 2013. http://abstracts.aapspharmaceutica.com/ExpoAAPS09/CC/forms/attendee/index.aspx?content=sessionInfo&sessionId=2716.Applicant
- Kumamoto et al. “Induction of Tumor-Specific Protective Immunity by in situ Langerhans Cell Vaccine.” Nat. BioTechnol. 20.1(2002):64-69.Applicant
- Kumar et al. “Toll-Like Receptors and Innate Immunity.” Biochem. Biophys. Res. Commun. 388.4(2009):621-625.Applicant
- Kurts et al. “CD8 T Cell Ignorance or Tolerance to Islet Antigens Depends on Antigen Dose.” PNAS. 96.22(1999):12703-12707.Applicant
- Kwon et al. “Electrically Erodible Polymer Gel for Controlled Release of Drugs.” Nature. 354(1991):291-293.Applicant
- Kwon et al. “In vivo Targeting Dendritic Cells for Activation of Cellular Immunity Using Vaccine Carriers Based on pH-Responsive Microparticles.” PNAS. 102.51(2005):18264-18268.Applicant
- Langenkamp et al. “Kinetics of Dendritic Cell Activation: Impact on Priming of TH1, TH2 and Nonpolarized T Cells.” Nat. Immunol. 1.4(2000):311-316.Applicant
- Langer et al. “Tissue Engineering.” Science. 260(1993):920-926.Applicant
- Lanzavecchia et al. “Regulation of T Cell Immunity by Dendritic Cells.” Cell. 106.3(2001):263-266.Applicant
- Lao et al. “Magnetic and Hydrogel Composite Materials for Hyperthermia Applications.” J. Mater. Sci. Mater. Med. 15.10(2004):1061-1064.Applicant
- Lauterbach et al. “Mouse CD8α+ DCs and Human BDCA3+ DCs are Major Producers of IFN-λ in Response to Poly IC.” J. Exp. Med. 207.12(2010):2703-2717.Applicant
- Leach et al. “Coating of VEGF-Releasing Scaffolds with Bioactive Glass for Angiogenesis and Bone Regeneration.” Biomater. 27.17(2006):3249-3255.Applicant
- Lee et al. “Engineering Liver Tissue Spheroids with Inverted Colloidal Crystal Scaffolds.” Biomater. 30.27(2009):4687-4694.Applicant
- Lee et al. “Hydrogel Formation via Vell Crosslinking.” Adv. Mat. 15.21(2003):1828-1832.Applicant
- Lee et al. “Hydrogels for Tissue Engineering.” Chem. Rev. 101.7(2001):1869-1879.Applicant
- Lefaucheur et al. “The Cellular Events of Injured Muscle Regeneration Depend on the Nature of the Injury.” Neuromusc. Disorders. 5.6(1995):501-509.Applicant
- Lensch et al. “Scientific and Clinical Opportunities for Modeling Blood Disorders With Embyronic Stem Cells.” Blood. 107.7(2006):2605-2612.Applicant
- Leor et al. “Cells, Scaffolds, and Molecules for Myocardial Tissue Engineering.” Pharmacol. Therapeutics. 105(2005):151-163.Applicant
- Leshem et al. “Hepatocyte Growth Factor (HGF) Inhibits Skeletal Muscle Cell Differentiation: A Role for the bHLH Protein Twist and the cdk Inhibitor p27.” J. Cell. Physiol. 184(2000):101-109.Applicant
- Letsinger et al. “Phosphoramidate Analogs of Oligonucleotides.” J. Org. Chem. 35.11(1970):3800-3803.Applicant
- Li et al. “Effect of Growth Factors and Extracellular Matrix Materials on the Proliferation and Differentiation of Microencapsulated Myoblasts.” J. Biomater. Sci. Polym. Ed. 14.6(2003):533-549.Applicant
- Li et al. “Effects of Three-Dimensional Scaffolds on Cell Organization and Tissue Development.” Biotech. Bioprocess Eng. 6.5(2001):311-325.Applicant
- Li. “TNF-α is a Mitogen is Skeletal Muscle.” Am. J. Physiol. Cell Physiol. 285(2003):C370-C376.Applicant
- Lipton et al. “Developmental Fate of Skeletal Satellite Cells.” Science. 205(1979):1292-1294.Applicant
- Liu et al. “Nanostructured Materials Designed for Cell Binding and Transduction.” Biomacromolecules. 2.2(2001):362-368.Applicant
- Liu. “Dendritic Cell Subsets and Lineages, and Their Functions in Innate and Adaptive Immunity.” Cell. 106.3(2001):259-262.Applicant
- Lu et al. “Muscle-Derived Stem Cells Seeded Into Acellular Scaffolds Develop Calcium-Dependent Contractile Activity That is Modulated by Nicotinic Receptors.” Urology. 61.6(2003):1285-1291.Applicant
- Lubeck. “The Costs of Musculoskeletal Disease: Health Needs Assessment and Health Economics.” Best Pract. Res. Clin. Rheumatol. 17.3(2003):529-539.Applicant
- Lumelsky et al. “Differentiation of Embryonic Stem Cells to Insulin-Secreting Structures Similar to Pancreatic Islets.” Science. 292.5520(2001):1389-1394.Applicant
- Lutolf et al. “Repair of Bone Defects Using Synthetic Mimetics of Collagenous Extracellular Matrices.” Nat. Biotechnol. 21.5(2003):513-518.Applicant
- López et al. “Magnetic Applications of Polymer Gels.” Macromol. Symp. 166.1(2001):173-178.Applicant
- Mach et al. “Differences in Dendritic Cells Stimulated in Vivo by Tumors Engineered to Secrete Granulocyte-Macrophage Colony-Stimulating Factor or Flt3-Ligand.” Cancer Res. 60.12(2000):3239-3246.Applicant
- Magram et al. “IL-12-Deficient Mice are Defective but not Devoid of Type 1 Cytokine Responses.” Ann. N.Y. Acad. Sci. 795(1996):60-70.Applicant
- Maini. “Spatial and Spatio-Temporal Patterns in a Cell-Haptotaxis Model.” J. Math. Biol. 27.5(1989):507-522.Applicant
- Maley et al. “Extracellular Matrix, Growth Factors, Genetics: Their Influence on Cell Proliferation and Myotube Formation in Primary Cultures of Adult Mouse Skeletal Muscle.” Exp. Cell Res. 219.1(1995):169-179.Applicant
- Martinsen et al. “Alginate as Immobilization Material.” Biotech. Bioeng. 33.1(1989):79-89.Applicant
- Marui et al. “Simultaneous Application of Basic Fibroblast Growth Factor and Hepatocyte Growth Factor to Enhance the Blood Vessels Formation.” J. Vasc. Surg. 41.1(2005):82-90.Applicant
- Massia et al. “An RGD Spacing of 440 nm is Sufficient for Integrin αvβ3-Mediated Fibroblast Spreading and 140 nm for Focal Contact and Stress Fiber Formation.” J. Cell Biol. 114.5(1991):1089-1100.Applicant
- Matthew et al. “Subperiosteal Behaviour of Alginate and Cellulose Wound Dressing Materials.” Biomaterials. 16.4(1995):275-278.Applicant
- McKinney-Freeman et al. “Muscle-Derived Hematopoietic Stem Cells are Hematopoietic in Origin.” PNAS. 99.3(2002):1341-1346.Applicant
- McPherron et al. “Regulation of Skeletal Muscle Mass in Mice by a New TGF-β Superfamily Member.” Nature. 387(1997):83-90.Applicant
- Meier et al. “Peptide Nucleic Acids (PNAs)—Unusual Properties of Noionic Oligonucleotide Analogues.” Angew Chem. Int. Ed. 31.8(1992):1008-1010.Applicant
- Melero-Martin et al. “Engineering Robust and Functional Vascular Networks In Vivo With Human Adult and Cord Blood-Derived Progenitor Cells.” Circ. Res. 103.2(2008):194-202.Applicant
- Mellman et al. “Dendritic Cells: Specialized and Regulated Antigen Processing Machines.” Cell. 106.3(2001):255-258.Applicant
- Menetrey et al. “Suturing Versus Immobilization of a Muscle Laceration: A Morphological and Functional Study in a Mouse Model.” Am. J. Sports Med. 27.2(1999):222-229.Applicant
- Meraz et al. “Mesoporous Silicon Particles for the Presentation of Tumor Antigens and Adjuvant for Anti-Cancer Immunity.” Cancer Res. 71.S24(2011):159s-160s. (Abstract #P1-01-12).Applicant
- Meyer et al. “Clinical Investigations of Toll-Like Receptor Agonists.” Expert Opin. Investig. Drugs. 17.7(2008):1051-1065.Applicant
- Meylan et al. “Intracellular Pattern Recognition Receptors in the Host Response.” Nature. 442.7098(2006):39-44.Applicant
- Miller et al. “Hepatocyte Growth Factor Affects Satellite Cell Activation and Differentiation in Regenerating Skeletal Muscle.” Am. J. Physiol. Cell Physiol. 278(2000):C174-C181.Applicant
- Miller et al. “Lipopolysaccharide Sequestrants: Structural Correlates of Activity and Toxicity in Novel Acylhomospermines.” J. Med. Chem. 48(2005):2589-2599.Applicant
- Mitchell et al. “The Exogenous Administration of Basic Fibroblast Growth Factor to Regenerating Skeletal Muscle in Mice Does Not Enhance the Process of Regeneration.” Growth Factors. 13.1-2(1996):37-55.Applicant
- Miyata et al. “Biomolecule-Sensitive Hydrogels.” Adv. Drug Deliv. Rev. 54.1(2002):79-98.Applicant
- Mohan et al. “Novel Porous, Polysaccharide Scaffolds for Tissue Engineering Applications.” Trends Biomater. Artif. Organs. 18.2(2005):219-224.Applicant
- Moioli et al. “Matrices and Scaffolds for Drug Delivery in Dental, Oral and Craniofacial Tissue Engineering.” Adv. Drug Deliv. Rev. 59.4-5(2007):308-324.Applicant
- Mooney et al. “Switching From Differentiation to Growth in Hepatocytes: Control by Extracellular Matrix.” J. Cell. Phys. 151.3(1992):497-505.Applicant
- Moser et al. “Dendritic Cell Regulation of TH1-TH2 Regulation.” Nat. Immunol. 1.3(2000):199-205.Applicant
- Murdan. “Electro-Responsive Drug Delivery from Hydrogels.” J. Control. Release. 92(2003):1-17.Applicant
- Nagai et al. “A Variant of Yellow Fluorescent Protein with Fast and Efficient Maturation for Cell-Biological Applications.” Nat. Biotechnol. 20.1(2002):87-90.Applicant
- Naik et al. “Development of Plasmacytoid and Conventional Dendritic Cell Subtypes From Single Precursor Cells Derived in vitro and in vivo.” Nat. Immunol. 8.11(2007):1217-1226.Applicant
- Nair et al. “Polymers as Biomaterials for Tissue Engineering and Controlled Drug Delivery.” Adv. Biochem. Eng. Biotechnol. 102(2006):47-90.Applicant
- NCBI Accession No. NM_000758, Apr. 1, 2012.Applicant
- NCBI Accession No. NM_003265, Dec. 30, 2012.Applicant
- NCBI Accession No. NM_004119, Apr. 14, 2013.Applicant
- NCBI Accession No. NM_006274.2, Mar. 31, 2013.Applicant
- NCBI Accession No. NM_017442, Apr. 14, 2012.Applicant
- NCBI Accession No. NP_000749.2, Apr. 1, 2012.Applicant
- NCBI Accession No. NP_001020537, Jan. 30, 2011.Applicant
- NCBI Accession No. NP_001020538, Jan. 30, 2011.Applicant
- NCBI Accession No. NP_001020539, Jan. 30, 2011.Applicant
- NCBI Accession No. NP_001020540, Jan. 30, 2011.Applicant
- NCBI Accession No. NP_001028928, Jan. 30, 2011.Applicant
- NCBI Accession No. NP_003367, Jan. 30, 2011.Applicant
- NCBI Accession No. NP_059138, Apr. 14, 2012.Applicant
- Nehls et al. “A Novel, Microcarrier-Based in Vitro Assay for Rapid and Reliable Quantification of Three-Dimensional Cell Migration and Angiogenesis.” Microvasc. Res. 50.3(1995):311-322.Applicant
- Niamlang et al. “Electrically Controlled Release of Salicylic Acid from poly(p-phenylene vinylene) Polyacrylamide Hydrogels.” Int. J. Pharm. 371(2009):126-133.Applicant
- Nicodemus et al. “Cell Encapsulation in Biodegradable Hydrogels for Tissue Engineering Applications.” Tissue Eng. Part B Rev. 14.2(2008):149-165.Applicant
- Noguera-Troise et al. “Blockade of Dll4 Inhibits Tumour Growth by Promoting Non-Productive Angiogenesis.” Nature. 444.7122(2006):1032-1037.Applicant
- O'Garra et al. “Are Dendritic Cells Afraid of Commitment?” Nat. Immunol. 5.12(2004):1206-1208.Applicant
- O'Shea et al. “Type 1 IFNs and Regulation of TH1 Responses: Enigmas Both Resolved and Emerge.” Nat. Immunol. 1.1(2000):17-19.Applicant
- Ohashi et al. “Surgical Excision Combined with Autologous Whole Tumor Cell Vaccination is an Effective Therapy for Murine Neuroblastoma.” J. Ped. Surg. 41(2006):1361-1368.Applicant
- Ohlstein et al. “The Stem Cell Niche: Theme and Variations.” Curr. Opin. Cell Biol. 16.6(2004):693-699.Applicant
- Oldenburg et al. “TLR13 Recognizes Bacterial 23S rRNA Devoid of Erythromycin Resistance-Forming Modification.” Science. 337.6098(2012):1111-1115.Applicant
- Oldenhove et al. “Decrease of Foxp3+ Treg Cell No. And Acquisition of Effector Cell Phenotype During Lethal Infection.” Immunity. 31.5(2009):772-786.Applicant
- Orner et al. “Arrays for the Combinatorial Exploration of Cell Adhesion.” J. Am. Chem. Soc. 126.35(2004):10808-10809.Applicant
- Ota et al. “Percutaneous Subxiphoid Access to the Epicardium Using a Miniature Crawling Robotic Device.” Innovations. 1.5(2006):227-231.Applicant
- Overwijk et al. “Tumor Regression and Autoimmunity After Reversal of a Functionally Tolerant State of Self-Reactive CD8+ T Cells.” J. Exp. Med. 198.4(2003):569-580.Applicant
- Ozawa et al. “Microenvironmental VEGF Concentration, Not Total Dose, Determines a Threshold Between Normal and Aberrant Angiogenesis.” J. Clin. Invest. 113.4(2004):516-527.Applicant
- Padilla et al. “Insufficient TLR Activation Contributes to the Slow Development of CD8+ T Cell Responses in Trypanosoma cruzi Infection.” J. Immunol. 183(2009):1245-1252.Applicant
- Palacio et al. “Interleukin 10 and Tumor Necrosis Factor α Gene Expression in Respiratory and Peripheral Muscles.” Arch. Bronconeumol. 38.7(2002):311-316. (Spanish Original and English Abstract).Applicant
- Paradee et al. “Effects of Crosslinking Ratio, Model Drugs, and Electric Field Strength on Electrically Controlled Release for Alginate-Based Hydrogels.” J. Mater. Sci. Mater. Med. 23(2012):999-1010.Applicant
- Parker et al. “Effect of Mitoxantrone on Outcome of Children with First Relapse of Acute Lymphoblastic Leukemia (ALL R3): An Open-Label Radomised Trial.” Lancet. 376(2010):2009-2017.Applicant
- Partridge et al. “Conversion of mdx Myofibres From Dystrophin-Negative to—Positive by Injection of Normal Myoblasts.” Nature. 337.6203(1989):176-179.Applicant
- Pedersen et al. “Induction of Regulatory Dendritic Cells by Desamethasone and 1α,25-Dihydroxyvitamin D3.” Immunol. Lett. 91(2004):63-69.Applicant
- Pelinkovic et al. “Tissue Engineering and Gene Therapy of the Muscoskeletal System with Muscle Cells.” Z. Orthop. Ihre Grenzgeb. 138.5(2000):402-406. (German Original and English Abstract).Applicant
- Peters et al. “Engineering Vascular Networks in Porous Polymer Matrices.” J. Biomed. Mater. Res. 60.4(2002):668-678.Applicant
- Phillippi. “Patterning of Multiple Cell Lineages from a Single Stem Cell Population.” Annual Meeting of the American Society for Cell Biology. (Dec. 10, 2006).Applicant
- Pluen et al. “Role of Tumor-Host Interactions in Interstitial Diffusion of Macromolecules: Cranial vs. Subcutaneous Tumors.” PNAS. 98.8(2001):4628-4633.Applicant
- Pooyan et al. “Conjugates Beating Multiple Formyl-Methionyl Peptides Display Enhanced Binding to, but not Activation of Phagocytic Cells.” Bioconjugate Chem. 13.2(2002):216-223.Applicant
- Pope et al. “Organ-Specific Regulation of the CD8 T Cell Response to Listeria monocytogenes Infection.” J. Immunol. 166(2001):3402-3409.Applicant
- Porter et al. “Separation of Natural Populations of Coliform Bacteria from Freshwater and Sewage by Magnetic-Bead Cell Sorting.” J. Microbiol. Meth. 33.3(1998):221-226.Applicant
- Pouzet et al. “Factors Affecting Functional Outcome After Autologous Skeletal Myoblast Transplantation.” Ann. Thorac. Surg. 71(2001):844-851.Applicant
- Pulendran et al. “Flt3-Ligand and Granulocyte Colony-Stimulating Factor Mobilize Distinct Human Dendritic Cell Subsets In Vivo.” J. Immunol. 165(2000):566-572.Applicant
- Qu et al. “Development of Approaches to Improve Cell Survival in Myoblast Transfer Therapy.” J. Cell Biol. 142.5(1998):1257-1267.Applicant
- Qu-Petersen et al. “Identification of a Novel Population of Muscle Stem Cells in Mice: Potential for Muscle Regeneration.” J. Cell Biol. 157.5(2002):851-864.Applicant
- Quezada et al. “CTLA4 Blockade and GM-CSF Combination Immunotherapy Alters the Intratumor Balance of Effector and Regulatory T Cells.” J. Clin. Invest. 116.7(2006):1935-1945.Applicant
- Qui et al. “Environment-Sensitive Hydrogels for Drug Delivery.” Adv. Drug Deliv. Rev. 53.3(2001):321-339.Applicant
- Rajagopalan et al. “Regional Angiogenesis With Vascular Endothelial Growth Factor in Peripheral Arterial Disease: A Phase II Randomized, Double-Blind, Controlled Study of Adenoviral Delivery of Vascular Endothelial Growth Factor 121 in Patients With Disabling Intermittent Claudication.” Circulation. 108.16(2003):1933-1938.Applicant
- Randolph et al. “Migration of Dendritic Cell Subsets and Their Precursors.” Annu. Rev. Immunol. 26(2008):293-316.Applicant
- Rappolee et al. “Macrophage-Derived Growth Factors.” Curr. Top. Microbiol. Immunol. 181(1992):87-140.Applicant
- Rapraeger. “Syndecan-Regulated Receptor Signaling.” J. Cell. Biol. 149.5(2000):995-998.Applicant
- Reddy et al. “Exploiting Lymphatic Transport and Complement Activation in Nanoparticle Vaccines.” Nat. Biotechnol. 25.10(2007):1159-1164.Applicant
- Reimann et al. “Satellite Cells in Normal and Regenerated Soleus Muscles of mdx and Control Mice.” Eur. J. Neurosci. 10(1998):366. (Abstract #153.07).Applicant
- Reis e Sousa. “Activation of Dendritic Cells: Translating Innate into Adaptive Immunity.” Curr. Opin. Immunol. 16.1(3005):21-25.Applicant
- Rhoads et al. “Satellite Cell-Mediated Angiogenesis in vitro Coincides with a Functional Hypoxia-Inducible Factor Pathway.” Am. J. Physiol. Cell Physiol. 296.6(2009):C1321-C1328.Applicant
- Richards Grayson et al. “Multi-Pulse Drug Delivery From a Resorbable Polymeric Microchip Device.” Nat. Mater. 2.11(2003):767-772.Applicant
- Richardson et al. “Polymeric System for Dual Growth Factor Delivery.” Nat. Biotech. 19.11(2001):1029-1034.Applicant
- Riddle et al. “Role of Poly(lactide-co-glycolide) Particle Size on Gas-Foamed Scaffolds.” J. Biomater. Sci. Polym. Ed. 15.12(2004):1561-1570.Applicant
- Ridgway et al. “Inhibition of Dll4 Signalling Inhibits Tumour Growth by Deregulating Angiogenesis.” Nature. 444.7122(2006):1083-1087.Applicant
- Rinderknecht et al. “The Amino Acid Sequence of Human Insulin-Like Growth Factor I and its Structural Homology with Proinsulin.” J. Biol. Chem. 253.8(1978):2769-2776.Applicant
- Rizzo et al. “An Improved Cyan Fluorescent Protein Variant Useful for FRET.” Nat. Biotechnol. 22.4(2004):445-449.Applicant
- Rosenberg et al. “Cancer Immunotherapy: Moving Beyond Current Vaccines.” Nat. Med. 10.9(2004):909-915.Applicant
- Roth et al. “SC68896, a Novel Small Molecule Proteasome Inhibitor, Exerts Antiglioma Activity In vitro and In vivo.” Clin. Cancer Res.15.21(2009):6609-6618.Applicant
- Rowlands et al. “Directing Osteogenic and Myogenic Differentiation of MSCs: Interplay of Stiffness and Adhesive Ligand Presentation.” Am. J. Physiol Cell Physiol. 295(2008):1037-1044.Applicant
- Rowley et al. “Alginate Type and RGD Density Control Myoblast Phenotype.” J. Biomed. Mater. Res. 60.2(2002):217-233.Applicant
- Rowley et al. “Biomaterials to Spatially Regulate Cell Fate.” Adv. Mater. 14.12(2002):886-889.Applicant
- Rowley. “Alginate Hydogels as Synthetic Extracellular Matrix Materials.” Biomaterials. 20.1(1999):45-53.Applicant
- Rubin et al. “Dissociation of Heparan Sulfate and Receptor Binding Domains of Hepatocyte Growth Factor Reveals That Heparan Sulfate-c-Met Interaction Factilitates Signaling.” J. Biol. Chem. 276.35(2001):32977-32983.Applicant
- Ryten et al. “ATP Regulates the Differentiation of Mammalian Skeletal Muscle by Activation of a P2X5 Receptor on Satellite Cells.” J. Cell. Biol. 158.2(2002):345-355.Applicant
- Ryu et al. “The Construction of Three-Dimensional Micro-Fluidic Scaffolds of Biodegradable Polymers by Solvent Vapor Based Bonding of Micro-Molded Layers.” Biomaterials. 28.6(2007):1174-1184.Applicant
- Salem et al. “Defining the Antigen-Specific T-Cell Response to Vaccination and Poly(I:C)/TLR3 Signaling.” J. Immunother. 28.3(2005):220-228.Applicant
- Salvador et al. “Combination of Immune Stimulating Adjuvants With Poly(lactide-co-glycolide) Microspheres Enhances the Immune Response of Vaccines.” Vaccine. 30.3(2011):589-596.Applicant
- Salvay et al. “Inductive Tissue Engineering with Protein and DNA-Releasing Scaffolds.” Mol. Biosyst. 2.1(2006):36-48.Applicant
- Sano et al. “Swift Development of Protective Effector Functions in Naive CD8+ T Cells Against Malaria Liver Stages.” J. Exp. Med. 194.2(2001):173-179.Applicant
- Sansonetti. “The Innate Signaling of Dangers and the Dangers of Innate Signaling.” Nat. Immunol. 7.12(2006):1237-1242.Applicant
- Sarkar et al. “Condensation of Oligonucleotides Assembled into Nicked and Gapped Duplexes: Potential Structures for Oligonucleotide Delivery.” Nucleic Acids Res. 33.1(2005):143-151.Applicant
- Saxena et al. “Skeletal Muscle Tissue Engineering Using Isolated Myoblasts on Synthetic Biodegradable Polymers: Preliminary Studies.” Tissue Eng. 5.6(1999):525-532.Applicant
- Schaefer et al. Innate mmunity in the Human Female Reproductive Tract: Antiviral Response of Uterine Epithelial Cells to TLR3 Agonist Poly(I:C). J. Immunol. 174(2005):992-1002.Applicant
- Scheel et al. “Toll-Like Receptor-Dependent Activation of Several Human Blood Cell Types by Protamine Condensed mRNA.” Eur. J. Immunol. 35(2005):1557-1566.Applicant
- Schijns et al. “Mice Lacking IL-12 Develop Polarized Th1 Cells During Viral Infection.” J. Immunol. 160(1998):3958-3964.Applicant
- Schnorrer et al. “The Dominant Role of CD8+ Dendritic Cells in Cross-Presentation is not Dictated by Antigen Capture.” PNAS. 103.28(2006):10729-10734.Applicant
- Schuler et al. “The Use of Dendritic Cells in Cancer Immunotherapy.” Curr. Opin. Immunol. 15.2(2003):138-147.Applicant
- Seale et al. “Pax7 is Required for the Specification of Myogenic Satellite Cells.” Cell. 102.6(2000):777-786.Applicant
- Shakweh et al. “Design and Characterisation of Poly(lactide-co-glycolide) Small Particulate Systems for the Delivery of Immunostimulant CpG Oligonucleotide.” J. Nanosci. Nanotechnol. 6.9-10(2006):2811-2820.Applicant
- Shaner et al. “Improved Monomeric Red, Orange and Yellow Fluorescent Proteins Derived from Discosoma sp. Red Fluorescent Protein.” Nat. Biotechnol. 22.12(2004):1567-1572.Applicant
- Shansky et al. “Letter to the Editor: A Simplified Method for Tissue Engineering Skeletal Muscle Organoids In Vitro.” In Vitro Cell. Dev. Biol. 33(1997):659-661.Applicant
- Sheehan et al. “Skeletal Muscle Satellite Cell Proliferation in Response to Members of the Fibroblast Growth Factor Family and Hepatocyte Growth Factor.” J. Cell. Physiol. 181.3(1999):499-506.Applicant
- Sheridan et al. “Bioabsorbable Polymer Scaffolds for Tissue Engineering Capable of Sustained Growth Factor Delivery.” J. Control. Release. 64.1-3(2000):91-102.Applicant
- Shi et al. “A Novel Toll-Like Receptor that Recognizes Vascular Stomatitis Virus.” J. Biol. Chem. 286.6(2011):4517-4524.Applicant
- Shoichet et al. “Stability of Hydrogels Used in Cell Encapsulation: An In Vitro Comparison of Alginate and Agarose.” Biotechnol. Bioeng. 50(1996):374-381.Applicant
- Shortman et al. “Steady-State and Inflammatory Dendritic-Cell Development.” Nat. Rev. Immunol. 7(2007):19-30.Applicant
- Sick et al. “WNT and DKK Determine Hair Follicle Spacing Through a Reaction-Diffusion Mechanism.” Science. 314.5804(2006):1447-1450.Applicant
- Silva et al. “Material-Based Deployment Enhances Efficacy of Endothelial Progenitor Cells.” PNAS. 105.38(2008):14347-14352.Applicant
- Silva et al. “Spatiotemporal Control of Vascular Endothelial Growth Factor Delivery From Injectable Hydrogels Enhances Angiogenesis.” J. Thromb. Haemost. 5.3(2007):590-598.Applicant
- Skokos et al. “CD8− DCs Induce IL-12-Independent Th1 Differentiation Through Delta 4 Notch-Like Ligand in Response to Bacterial LPS.” J. Exp. Med. 204.7(2007):1525-1531.Applicant
- Skuk et al. “Efficacy of Myoblast Transplantation in Nonhuman Primates Following Simple Intramuscular Cell Injections: Toward Defining Strategies Applicable to Humans.” Exp. Neurol. 175.1(2002):112-126.Applicant
- Skuk et al. “Myoblast Transplantation: The Current Status of a Potential Therapeutic Tool for Myopathies.” J. Musc. Res. Cell. Motil. 24.4-6(2003):285-300.Applicant
- Smidsrød et al. “Alginate as Immobilization Matrix for Cells.” Trends Biotechnol. 8.3(1990):71-78.Applicant
- Sohier et al. “Critical Factors in the Design of Growth Factor Releasing Scaffolds for Cartilage Tissue Engineering.” Exp. Opin. Drug Deliv. 5.5(2008):543-566.Applicant
- Steinman et al. “Taking Dendritic Cells into Medicine.” Nature. 449.7161(2007):419-426.Applicant
- Storrie et al. “Sustained Delivery of Plasmid DNA From Polymeric Scaffolds for Tissue Engineering.” Adv. Drug Deliv. Rev. 58.4(2006):500-514.Applicant
- Straub et al. “Animal Models for Muscular Dystrophy Show Different Patterns of Sarcolemmal Distruption.” J. Cell Biol. 139.2(1997):375-385.Applicant
- Sun et al. “Sustained Vascular Endothelial Growth Factor Delivery Enhances Angiogenesis and Perfusion in Ischemic Hind Limb.” Pharm. Res. 22.7(2005):1110-1116.Applicant
- Takahashi et al. “Induction of Pluripotent Stem Cells from Adult Human Fibroblasts by Defined Factors.” Cell. 131.5(2007):861-872.Applicant
- Takeshita et al. “Therapeutic Angiogenesis.” J. Clin. Invest. 93.2(1994):662-670.Applicant
- Tamura et al. “Immunotherapy of Tumors with Autologous Tumor-Derived Heat Shock Protein Preparations.” Science. 278.3(1997):117-120.Applicant
- Tanaka et al. “Collapse of Gels in an Electric Field.” Science. 218(1982):467-469.Applicant
- Tatsumi et al. “HGF/SF is Present in Normal Adult Skeletal Muscle and Is Capable of Activating Satellite Cells.” Dev. Biol. 194.1(1998):114-128.Applicant
- ten Dijke et al. “Growth Factors for Wound Healing.” Nat. Biotechnol. 7(1989):793-798.Applicant
- Thurston et al. “The Delta Paradox: DLL4 Blockade Leads to More Tumour Vessels but Less Tumour Growth.” Nat. Rev. Cancer. 7.5(2007):327-331.Applicant
- Tidball. “Inflammatory Cell Response to Acute Muscle Injury.” Med. Sci. Sports Exerc. 27.7(1995):1022-1032.Applicant
- Tomer et al. “Electrically Controlled Release of Macromolecules from Cross-Linked Hyaluronic Acid Hydrogels.” J. Control. Release. 33.3(1995):405-413.Applicant
- Tourniaire et al. “Polymer Microarrays for Cellular Adhesion.” Chem. Commun. 20(2006):2118-2120.Applicant
- Tsien. “The Green Fluorescent Protein.” Annu. Rev. Biochem. 67(1998):509-544.Applicant
- Turing. “Discussion: Turing's Theory of Morphogenesis—It's Influence on Modelling Biological Pattern and Form.” Bull. Math. Biol. 52.1-2(1990):119-159.Applicant
- Turing. “The Chemical Basis of Morphogenesis.” Philosophical Transactions of the Royal Society of London. Series B. 237.641(1952):37-72.Applicant
- Uchida et al. “Immunization by Particle Bombardment of Antigen-Loaded poly-(DL-lactide-co-glycolide) Microspheres in Mice.” Vaccine. 12(2006):2120-2130.Applicant
- Ugarte et al. “Notch Signaling Enhances Osteogenic Differentiation While Inhibiting Adipogenesis in Primary Human Bone Marrow Stromal Cells.” Exp. Hematol. 37(2009):867-875.Applicant
- Urbanek et al. “Stem Cell Niches in the Adult Mouse Heart.” PNAS. 103.24(2006):9226-9231.Applicant
- van Duin et al. “Triggering TLR Signaling in Vaccination.” Trends Immunol. 27.1(2006):49-55.Applicant
- Vandenburgh et al. “Tissue-Engineered Skeletal Muscle Organoids for Reversible Gene Therapy.” Hum. Gene Ther. 17(1996):2195-2200.Applicant
- Vieira et al. “The Bulk of Endogenously Produced IgG2a is Eliminated From the Serum of Adult C57BL/6 Mice With a Half-Life of 6-8 Days.” Eur. J. Immunol. 16.7(1986):871-874.Applicant
- Vieira et al. “The Half-Lives of Serum Immunoglobulins in Adult Mice.” Eur. J. Immunol. 18.2(1988):313-316.Applicant
- Villadangos et al. “Intrinsic and Cooperative Antigen-Presenting Functions of Dendritic-Cell Subsets in vivo.” Nat. Rev. Immunol. 7.7(2007):543-555.Applicant
- Villadangos. “Presentation of Antigens by MHC Class II Molecules: Getting the Most Out of Them.” Molec. Immunol. 38.5(2001):329-346.Applicant
- von Dassow et al. “The Segment Polarity Network is a Robust Developmental Module.” Nature. 406.6792(2000):188-192.Applicant
- Wakim et al. “Dendritic Cell-Induced Memory T Cell Activation in Nonlymphoid Tissues.” Science. 319(2008):198-202.Applicant
- Waldron-Lynch et al. “Advances in Type 1 Diabetes Therapeutics: Immunomodulation and β-Cell Savage.” Endocrinol. Metab. Clin. North Am. 38.2(2009):303-317.Applicant
- Wan et al. “Peritoneal Macrophage Uptake, Pharmacokinetics and Biodistribution of Macrophage-Targeted PEG-fMLF (N-Formyl-Methionyl-Leucyl-Phenylalanine) Nanocarriers for Improving HIV Drug Delivery.” Pharm. Res. 24.11(2007):2110-2119.Applicant
- Wang et al. “Biological Activity of Bevacizumab, a Humanized Anti-VEGF Antibody in vitro.” Angiogenesis. 7.4(2004):335-345.Applicant
- Wang et al. “Evolution of New Nonantibody Proteins via Iterative Somatic Hypermutation.” PNAS. 101.48(2004):16745-16749.Applicant
- Wei et al. “Global Mapping of H3K4me3 and H3K27me3 Reveals Specificity in Plasticity in Lineage Fate Determination of Differentiating CD4+ T Cells.” Immunity. 30.1(2009):155-167.Applicant
- Wernig et al. “Function of Skeletal Muscle Tissue Formed After Myoblast Transplantation into Irradiated Mouse Muscles.” J. Physiol. 522.2(2000):333-345.Applicant
- White et al. “Leukemia Inhibitory Factor Enhances Regeneration in Skeletal Muscles After Myoblast Transplantation.” Musc. Nerve. 24.5(2001):695-697.Applicant
- World Health Organization. “Global Burden of Musculoskeletal Disease Revealed in new WHO Report.” Bull. World Health Organ. 81.11(2003):853-854.Applicant
- World Health Organization. “The World Health Report 2004: Changing History.” The World Health Report. (2004):1-169.Applicant
- Wright et al. “Muscle-Based Gene Therapy and Tissue Engineering for the Musculoskeletal System.” Drug Disc. Today. 6.14(2001):728-733.Applicant
- Xie et al. “Preparation and Application of Surface-Coated Superparamagnetic Nanobeads in the Isolation of Genomic DNA.” J. Magn. Magnetic Mater. 277.1(2004):16-23.Applicant
- Yancopoulos et al. “Vascular-Specific Growth Factors and Blood Vessel Formation.” Nature. 407.6801(2000):242-248.Applicant
- Yu et al. “Induced Pluripotent Stem Cell Lines Derived from Human Somatic Cells.” Science. 318.5858(2007):1917-1920.Applicant
- Yuen et al. “Mimicking Nature by Codelivery of Stimulant and Inhibitor to Create Temporally Stable and Spatially Restricted Angiogenic Zones.” PNAS. 107.42(2010):17933-17938.Applicant
- Yuk et al. “Electric Current-Sensitive Drug Delivery System Using Sodium Alginate/Polyacrylic Acid Composites.” Pharm. Res. 9.7(1992):955-957.Applicant
- Zammit et al. “Kinetics of Myoblast Proliferation Show That Resident Satellite Cells are Competent to Fully Regenerate Skeletal Muscle Fibers.” Exp. Cell Res. 281.1(2002):39-49.Applicant
- Zammit et al. “Muscle Satellite Cells Adopt Divergent Fates: A Mechanism for Self-Renewal?” J. Cell Biol. 166.3(2004):347-357.Applicant
- Zeltinger et al. “Effect of Pore Size and Void Fraction on Cellular Adhesion, Proliferation, and Matrix Deposition.” Tissue Eng. 7.5(2001):557-572.Applicant
- Zhang et al. “A Comparative Study of the Antigen-Specific Immune Response Induced by Co-Delivery of CpG OGN and Antigen Using Fusion Molecules or Biodegradable Microparticles.” J. Pharma. Sci. 98.12(2007):3283-3292.Applicant
- Zhao et al. “Active Scaffolds for On-Demand Drug and Cell Delivery.” PNAS. 108.1(2011):67-72.Applicant
- Zhao et al. “Directed Cell Migration via Chemoattractants Released from Degradable Microspheres.” Biomat. 26(2005):5048-5063.Applicant
- Zhou et al. “Microstructure and Mechanical Properties of Poly(L-lactide) Scaffolds Fabricated by Gelatin Particle Leaching Method.” J. Appl. Polymer Sci. 98(2005):1373-1379.Applicant