1. Introduction
The present invention relates to Serrate genes and their encoded protein products, as well as derivatives and analogs thereof. Production of Serrate proteins, derivatives, and antibodies is also provided. The invention further relates to therapeutic compositions and methods of diagnosis and therapy.
2. Background of the Invention
Genetic analyses in Drosophila have been extremely useful in dissecting the complexity of developmental pathways and identifying interacting loci. However, understanding the precise nature of the processes that underlie genetic interactions requires a knowledge of the protein products of the genes in question.
Embryological, genetic and molecular evidence indicates that the early steps of ectodermal differentiation in Drosophila depend on cell interactions (Doe and Goodman, 1985, Dev. Biol. 111:206-219; Technau and Campos-Ortega, 1986, Dev. Biol. 195:445-454; Vassin et al., 1985, J. Neurogenet. 2:291-308; de la Concha et al., 1988, Genetics 118:499-508; Xu et al., 1990, Genes Dev. 4:464-475; Artavanis-Tsakonas, 1988, Trends Genet. 4:95-100). Mutational analyses reveal a small group of zygotically-acting genes, the so called neurogenic loci, which affect the choice of ectodermal cells between epidermal and neural pathways (Poulson, 1937, Proc. Natl. Acad. Sci. 23:133-137; Lehmann et al., 1983, Wilhelm Roux's Arch. Dev. Biol. 192:62-74; Jurgens et al., 1984, Wilhelm Roux's Arch. Dev. Biol. 193:283-295; Wieschaus et al., 1984, Wilhelm Roux's Arch. Dev. Biol. 193:296-307; Nusslein-Volhard et al., 1984, Wilhelm Roux's Arch. Dev. Biol. 193:267-282). Null mutations in any one of the zygotic neurogenic loci--Notch (N), Delta (Dl), mastermind (mam), Enhancer of Split (E(spl), neuralized (neu), and big brain (bib)--result in hypertrophy of the nervous system at the expense of ventral and lateral epidermal structures. This effect is due to the misrouting of epidermal precursor cells into a neuronal pathway, and implies that neurogenic gene function is necessary to divert cells within the neurogenic region from a neuronal fate to an epithelial fate. Serrate has been identified as a genetic unit capable of interacting with the Notch locus (Xu et al., 1990, Genes Dev. 4:464-475). These genetic and developmental observations have led to the hypothesis that the protein products of the neurogenic loci function as components of a cellular interaction mechanism necessary for proper epidermal development (Artavanis-Tsakonas, S., 1988, Trends Genet. 4:95-100).
Mutational analyses also reveal that the action of the neurogenic genes is pleiotropic and is not limited solely to embryogenesis. For example, ommatidial, bristle and wing formation, which are known also to depend upon cell interactions, are affected by neurogenic mutations (Morgan et al., 1925, Bibliogr. Genet. 2:1-226; Welshons, 1956, Dros. Inf. Serv. 30:157-158; Preiss et al., 1988, EMBO J. 7:3917-3927; Shellenbarger and Mohler, 1978, Dev. Biol. 62:432-446; Technau and Campos-Ortega, 1986, Wilhelm Roux's Dev. Biol. 35 195:445-454; Tomlison and Ready, 1987, Dev. Biol. 120:366-376; Cagan and Ready, 1989, Genes Dev. 3:1099-1112).
Sequence analyses (Wharton et al., 1985, Cell 43:567-581; Kidd and Young, 1986, Mol. Cell. Biol. 6:3094-3108; Vassin, et al., 1987, EMBO J. 6:3431-3440; Kopczynski, et al., 1988, Genes Dev. 2:1723-1735) have shown that two of the neurogenic loci, Notch and Delta, appear to encode transmembrane proteins that span the membrane a single time. The Notch gene encodes a -300 kd protein (we use "Notch" to denote this protein) with a large N-terminal extracellular domain that includes 36 epidermal growth factor (EGF)-like tandem repeats followed by three other cysteine-rich repeats, designated Notch/lin-12 repeats (Wharton, et al., 1985, Cell 43:567-581; Kidd and Young, 1986, Mol. Cell. Biol. 6:3094-3108; Yochem, et al., 1988, Nature 335:547-550). Delta encodes a .about.100 kd protein (we use "Delta" to denote DLZM, the protein product of the predominant zygotic and maternal transcripts; Kopczynski, et al., 1988, Genes Dev. 2:1723-1735) that has nine EGF-like repeats within its extracellular domain (Vassin, et al., 1987, EMBO J. 6:3431-3440; Kopczynski, et al., 1988, Genes Dev. 2:1723-1735). Molecular studies have lead to the suggestion that Notch and Delta constitute biochemically interacting elements of a cell communication mechanism involved in early developmental decisions (Fehon et al., 1990, Cell 61:523-534).
The EGF-like motif has been found in a variety of proteins, including those involved in the blood clotting cascade (Furie and Furie, 1988, Cell 53: 505-518). In particular, this motif has been found in extracellular proteins such as the blood clotting factors IX and X (Rees et al., 1988, EMBO J. 7:2053-2061; Furie and Furie, 1988, Cell 30 53: 505-518), in other Drosophila genes (Knust et al., 1987 EMBO J. 761-766; Rothberg et al., 1988, Cell 55:1047-1059), and in some cell-surface receptor proteins, such as thrombomodulin (Suzuki et al., 1987, EMBO J. 6:1891-1897) and LDL receptor (Sudhof et al., 1985, Science 228:815-822). A protein binding site has been mapped to the EGF repeat domain in thrombomodulin and urokinase (Kurosawa et al., 1988, J. Biol. Chem 263:5993-5996; Appella et al., 1987, J. Biol. Chem. 262:4437-4440).
Citation of references hereinabove shall not be construed as an admission that such references are prior art to the present invention.
3. Summary of the Invention
The present invention relates to nucleotide sequences of Serrate genes (Drosophila Serrate and related genes of other species), and amino acid sequences of their encoded proteins, as well as derivatives (e.g., fragments) and analogs thereof. Nucleic acids hybridizable to or complementary to the foregoing nucleotide sequences are also provided. In a specific embodiment, the Serrate protein is a human protein.
The invention relates to Serrate derivatives and analogs of the invention which are functionally active, i.e., they are capable of displaying one or more known functional activities associated with a full-length (wild-type) Serrate protein. Such functional activities include but are not limited to antigenicity ability to bind (or compete with Serrate for binding) to an anti-Serrate antibody!, immunogenicity (ability to generate antibody which binds to Serrate), ability to bind (or compete with Serrate for binding) to Notch or other toporythmic proteins or fragments thereof ("adhesiveness"), ability to bind (or compete with Serrate for binding) to a receptor for Serrate. "Toporythmic proteins" as used herein, refers to the protein products of Notch, Delta, Serrate, Enhancer of split, and Deltex, as well as other members of this interacting gene family which may be identified, e.g., by virtue of the ability of their gene sequences to hybridize, or their homology to Delta, Serrate, or Notch, or the ability of their genes to display phenotypic interactions.
The invention further relates to fragments (and derivatives and analogs thereof) of Serrate which comprise one or more domains of the Serrate protein, including but not limited to the intracellular domain, extracellular domain, transmembrane domain, membrane-associated region, or one or more EGF-like (homologous) repeats of a Serrate protein, or any combination of the foregoing.
Antibodies to Serrate, its derivatives and analogs, are additionally provided.
Methods of production of the Serrate proteins, derivatives and analogs, e.g., by recombinant means, are also provided.
The present invention also relates to therapeutic and diagnostic methods and compositions based on Serrate proteins and nucleic acids. The invention provides for treatment of disorders of cell fate or differentiation by administration of a therapeutic compound of the invention. Such therapeutic compounds (termed herein "Therapeutics") include: Serrate proteins and analogs and derivatives (including fragments) thereof; antibodies thereto; nucleic acids encoding the Serrate proteins, analogs, or derivatives; and Serrate antisense nucleic acids. In a preferred embodiment, a Therapeutic of the invention is administered to treat a cancerous condition, or to prevent progression from a pre-neoplastic or non-malignant state into a neoplastic or a malignant state. In other specific embodiments, a Therapeutic of the invention is administered to treat a nervous system disorder or to promote tissue regeneration and repair.
In one embodiment, Therapeutics which antagonize, or inhibit, Notch and/or Serrate function (hereinafter "Antagonist Therapeutics") are administered for therapeutic effect. In another embodiment, Therapeutics which promote Notch and/or Serrate function (hereinafter "Agonist Therapeutics") are administered for therapeutic effect.
Disorders of cell fate, in particular hyperproliferative (e.g., cancer) or hypoproliferative disorders, involving aberrant or undesirable levels of expression or activity or localization of Notch and/or Serrate protein can be diagnosed by detecting such levels, as described more fully infra.
In a preferred aspect, a Therapeutic of the invention is a protein consisting of at least a fragment (termed herein "adhesive fragment") of Serrate which mediates binding to a Notch protein or a fragment thereof.
3.1. Definitions
As used herein, underscoring or italicizing the name of a gene shall indicate the gene, in contrast to its encoded protein product which is indicated by the name of the gene in the absence of any underscoring. For example, "Serrate" shall mean the Serrate gene, whereas "Serrate" shall indicate the protein product of the Serrate gene.
4. Description of the Figures
FIGS. 1A-1F. Phenotypic interactions between Notch and Serrate. (a) w.sup.a spl wing blade showing characteristic wild-type symmetry, venation, and marginal wing bristles and hairs. (b) nd/Y male. Distal wing notches and loss of posterior hairs are evident. (c) Ser.sup.D /+ heterozygote. Note similarity to nd/Y wing blade in FIG. 1b. (d) nd/Y; Ser.sup.D /+ transheterozygote wing blade. Mutant wing shows typical "fig leaf" shape, distorted wing veins, and loss of the majority of marginal bristles and hairs, with the exception of the anterodistal wing margin. (e) +/Y; Ser.sup.D /Dp(3R)CosP479BE (N.sup.+) male. The extra N.sup.+ copy suppresses the heterozygous Ser.sup.D dominant phenotype (compare to FIG. 1c). Also note suppression of the Confluens phenotype (see text). (f) Ser.sup.D /Ser.sup.D homozygote. Note the increased severity of the phenotype relative to Ser.sup.D /+(compare to FIG. 1c).
FIG. 2. Molecular map of the Serrate-encoding region. Approximately 85 kb of cloned genomic DNA from the 97 F chromosomal region are presented along with the restriction sites of three enzymes (B) BamHI; (E) EcoRI; (H) HindIII!. The locations of individual DNA alterations associated with Serrate allelic breakpoints are displayed above the genomic DNA (for descriptions of mutant alleles, see Section 6, infra; (rev 3 and rev 2-11) Ser.sup.rev 3 and Ser.sup.2-11, respectively; (R128) T(Y:3)R128. The shaded box from coordinates 0 to +3 represents the region of EGF homology detectable by Southern hybridization. The BamHI site adjacent to the EGF homology was arbitrarily chosen as position 0. Map orientation is with the centromere to the left. At the bottom of the figure are shown the individual recombinant phage isolates. The C1 and C3 cDNAs together constitute the larger of the two Serrate messages (.about.5.6 kb). Intron positions and coding capacities have been approximated solely upon cross hybridization of the cDNAs with the genomic DNA regions.
FIGS. 3A-3F. Serrate sequence analysis. The complete 5561 bp sequence (SEQ ID NO:1) derived from cDNAs C1 and C3 is shown. Nucleotide numbering is at left, amino acid numbering of the predicted open reading frame (ORF) is at right. The deduced protein product appears to be a transmembrane protein of 1404 amino acids (SEQ ID NO:2). Hydrophobic regions are denoted inside dashed boxes; amino acids 51 to 80 represent the likely signal peptide; amino acids 542 to 564 represent the potential membrane associated region; amino acids 1221 to 1245 represent the putative transmembrane domain. The first cysteine of each of the fourteen EGF-like repeats is denoted with a solid black box, and each repeat is underlined. The partial EGF-like repeat is considered "degenerate," since the fourth cysteine residue of this repeat has been changed to lysine (shown in boldface type at amino acid position 268). The initial cysteine of this repeat is denoted with an open box (amino acid 284), and the repeat is underlined. Amino acid insertions occur in the fourth, sixth, and tenth EGF-like repeats and are denoted by hatched underlines.
FIGS. 4A-4C. The Serrate transcript and deduced protein product. (a) The composite transcript shown was constructed from the C1 and C3 cDNAs, which overlap by 109 bp. Selected restriction enzyme cleavage sites are shown. The hatched box represents the 4212 bp ORF. Open boxes represent the 442 bp 5'-untranslated leader and 900 bp 3'-trailer sequence. (b) Kyte-Doolittle hydropathy plot of the deduced 1404 amino acid protein. (SP) Putative signal peptide; (MA) potential membrane associated region; (TM) likely transmembrane domain. (c) Cartoon representation of the gross structural features of the predicted Serrate protein. The darkly shaded region, including the partial EGF-like repeat (PR) is .about.250 amino acids in length and homologous to the Delta protein. Bracketed EGF-like repeats labelled (A, B, and C) contain insertions of amino acids and thus differ from the canonical EGF-like structure. Other features of the protein include the signal peptide (SP), a cysteine rich region, a transmembrane domain (TM), and an intracellular region of .about.160 amino acids.
FIG. 5. Temporal profile of Serrate transcript accumulation. Each lane contains five .mu.g of poly(A).sup.+ RNA. The stage of the embryonic RNAs is denoted in hours after egg laying; (L1, L2, and L3) RNA from the first, second and third larval instar periods; (EP and LP) early and late pupal stages; (M and F) adult male and female RNAs, respectively. A composite cDNA subclone (constructed from C1 and C3) was used as a hybridization probe. Serrate transcription is represented primarily as a 5.5 kb and 5.6 kb doublet beginning at 4-8 hours of embryogenesis. A transient 3.4 kb transcript is observed only during 2-4 hr of embryogenesis. The pupal and adult RNAs were fractionated on a separate gel for a longer period of time for better resolution. Equivalent loadings of RNA were noted by ethidium bromide staining of the RNA gels and confirmed by subsequent probing with an actin 5C probe shown at bottom; Fyrberg et al., 1983, Cell 33:115-123). Minor bands were not consistently observed in other blots and may reflect other EGF-homologous transcripts
FIGS. 6A-6L. Whole-mount in situ Serrate transcripts. Embryos are oriented with anterior to the left and dorsal side up unless otherwise noted. (a) Dorsal view of an early stage 10 embryo (mid-dorsal focal plane). Earliest expression occurs in the ectoderm of the foregut (FG) and presumptive clypeolabrum (CL). (b) Dorsal view of a germ band-extended embryo (late stage 10). Additional expression occurs near the proctodeum (PR), within the eighth (A8) and ninth (A9) abdominal segments, and in the labial and maxillary primordia (arrow). (c) Lateral view of an early stage 11 embryo. The lateral (LE) and ventral (VE) expression patterns are out of register and do not include the tracheal pits (TP). (d) Germ band-extended embryo (mid stage 11) dissected and flattened such that the dorsal surfaces are at the lateral edges. Extensive expression is observed between the labial (LB), maxillary (MX), and mandibular (MN) lobes, and within the hypopharynx (HP) and clypeolabrum (CL). Expression is also apparent in the salivary gland placodes (SP) that have moved to the ventral midline. Note relationship between lateral and ventral patterns and elaboration of expression in the tail region presumptive telson (TL)!. (e) Germ band-retracting embryo (stage 12; lateral view). Lateral expression (LE) is beginning to coalesce. (f) Lateral view of a germ band-retracted embryo (stage 13). The lateral expression is beginning to extend both dorsally and ventrally in each thoracic and abdominal segment and is most pronounced in the first thoracic segment (T1). A portion of the lateral expression now appears to include the presumptive trachea (T). Ventrally, note different expression (VE) patterns in the thoracic versus abdominal segments. (g) Lateral view of an early stage 14 embryo. Outline of the presumptive trachea (T) is distinct from the overlying epidermal expression. Arrows denote the zigzag pattern of lateral expression. (h) Dissected embryo (stage 14) opened along the dorsal midline and laid flat. Two areas of hindgut expression (HG1 and HG2) are apparent; HGI occurs near the origin of the Malpighian tubules. (i) Ventral view of a stage-16 embryo focusing on the ventral nerve cord (VNC). Earlier expression in the salivary gland placodes (SP in panel d) now constitutes the SD. Expression in the proventriculus (PV) and the maxillary/mandibular region (MX/MN) is slightly out of focus. (j) Dorsomedial focal plane of same embryo as in (i); head involution is nearly complete. The in-pocketings of expression in the thoracic'segments (T1, T2, and T3) may represent imaginal disc primordia. Pharyngeal expression (PH) is a combination of clypeolabrum and hypopharyngeal expression noted earlier. (k) Dorsal view of the same embryo as in (i) and (j). Note individual expressing cells in the brain lobes (BC). Expression in the fully differentiated trachea (T) and hindgut (H1) is evident. (1) Flattened preparation of early stage 16 embryo. Expression within the telson (TL) now constitutes a ring around the presumptive anal pads.
FIG. 7. Amino acid comparison of amino-terminal Serrate-Delta homology. Conserved regions are indicated at the top of the figure (*=identical amino acids; '=conservative changes in sequence). Serrate (see SEQ ID NO:2) is shown above line, Delta (SEQ ID NO:4) below. The sequence begins at Serrate amino acid position 59; the partial EGF-like repeat of both Serrate and Delta is boxed. The Serrate amino acid sequence (amino acids 79-282 of FIG. 3) placed into the chimeric AEGF Notch construct and determined to be sufficient for Notch binding is presented in boldface type. The positions of the synthetic degenerate primers (designated FLE1 through FLE4R) are shown; refer to FIG. 8 for nucleotide composition.
FIGS. 8A-8C. Nucleotide comparison of amino-terminal Serrate-Delta homology. The nucleotide sequence corresponding to the amino acid sequence in FIG. 7 is shown (Serrate sequence: see SEQ ID NO:1; Delta sequence: SEQ ID NO:3). The DNA encoding the partial EGF-repeat is boxed. The Serrate nucleotide sequence (nucleotides 676-1287 of FIG. 3) placed into the chimeric .DELTA.EGF Notch construct determined to be sufficient for Notch binding is presented in boldface type.
FIGS. 9A-9G. Nucleotide sequence (SEQ ID NO:5) and protein sequence (SEQ ID NO:6) of human Serrate cDNA homolog 39.
FIGS. 10A-10E. Preliminary nucleotide sequence (FIGS. 10A-10D; SEQ ID NO:7) and amino acid sequence (FIG. 10E; SEQ ID NO:8) of human Serrate cDNA homolog 15(1). Both the nucleotide and amino acid sequences are partial, with errors. In particular, there appears to be a frameshift after the signal sequence and some error (compression in the reading of the sequence).
FIGS. 11A-11B. Nucleotide sequence (SEQ ID NO:9) of chick Serrate (C-Serrate) cDNA.
FIGS. 12A-12B. Amino acid sequence (SEQ ID NO:10) of C-Serrate (lacking the amino-terminus of the signal sequence). The putative cleavage site following the signal sequence (marking the predicted amino-terminus of the mature protein) is marked with an arrowhead; the DSL domain is indicated by asterisks; the EGF-like repeats (ELRs) are underlined with dashed lines; the cysteine rich region between the ELRs and the transmembrane domain is marked between arrows, and the single transmembrane domain (between amino acids 1042 and 1066) is shown in bold.
FIG. 13. Alignment of the amino terminal sequences of Drosophila melanogaster Delta (SEQ ID NO:4) and Serrate (SEQ ID NO:2) with C-Serrate (SEQ ID NO:10). The region shown extends from the end of the signal sequence to the end of the DSL domain. The DSL domain is indicated. Identical amino acids in all three proteins are boxed.
FIG. 14. Diagram showing the domain structures of Drosophila Delta and Drosophila Serrate compared with C-Serrate. The second cysteine-rich region just downstream of the EGF repeats, present only in C-Serrate and Drosophila Serrate, is not shown. Hydrophobic regions are shown in black; DSL domains are checkered and EGF-like repeats are hatched.
5. Detailed Description of the Invention
The present invention relates to nucleotide sequences of Serrate genes, and amino acid sequences of their encoded proteins. The invention further relates to fragments and other derivatives, and analogs, of Serrate proteins. Nucleic acids encoding such fragments or derivatives are also within the scope of the invention. The invention provides Serrate genes and their encoded proteins of many different species. The Serrate genes of the invention include Drosophila Serrate and related genes (homologs) in species other than Drosophila. In specific embodiments, the Serrate genes and proteins are from vertebrates, or more particularly, mammals. In a preferred embodiment of the invention, the Serrate protein is a human protein. Production of the foregoing proteins and derivatives, e.g., by recombinant methods, is provided.
The invention relates to Serrate derivatives and analogs of the invention which are functionally active, i.e., they are capable of displaying one or more known functional activities associated with a full-length (wild-type) Serrate protein. Such functional activities include but are not limited to antigenicity ability to bind (or compete with Serrate for binding) to an anti-Serrate antibody!, immunogenicity (ability to generate antibody which binds to Serrate), ability to bind (or compete with Serrate for binding) to Notch or other toporythmic proteins or fragments thereof ("adhesiveness"), ability to bind (or compete with Serrate for binding) to a receptor for Serrate. "Toporythmic proteins" as used herein, refers to the protein products of Notch, Delta, Serrate, Enhancer of split, and Deltex, as well as other members of this interacting gene family which may be identified, e.g., by virtue of the ability of their gene sequences to hybridize, or their homology to Delta, Serrate, or Notch, or the ability of their genes to display phenotypic interactions.
The invention further relates to fragments (and derivatives and analogs thereof) of Serrate which comprise one or more domains of the Serrate protein, including but not limited to the intracellular domain, extracellular domain, transmembrane domain, membrane-associated region, or one or more EGF-like (homologous) repeats of a Serrate protein, or any combination of the foregoing.
Antibodies to Serrate, its derivatives and analogs, are additionally provided.
As demonstrated infra, Serrate plays a critical role in development and other physiological processes, in particular, as a ligand to Notch, which is involved in cell fate (differentiation) determination. In particular, Serrate is believed to play a major role in determining cell fates in the central nervous system. The nucleic acid and amino acid sequences and antibodies thereto of the invention can be used for the detection and quantitation of Serrate mRNA and protein of human and other species, to study expression thereof, to produce Serrate and fragments and other derivatives and analogs thereof, in the study and manipulation of differentiation and other physiological processes. The present invention also relates to therapeutic and diagnostic methods and compositions based on Serrate proteins and nucleic acids. The invention provides for treatment of disorders of cell fate or differentiation by administration of a therapeutic compound of the invention. Such therapeutic compounds (termed herein "Therapeutics") include: Serrate proteins and analogs and derivatives (including fragments) thereof; antibodies thereto; nucleic acids encoding the Serrate proteins, analogs, or derivatives; and Serrate antisense nucleic acids. In a preferred embodiment, a Therapeutic of the invention is administered to treat a cancerous condition, or to prevent progression from a pre-neoplastic or non-malignant state into a neoplastic or a malignant state. In other specific embodiments, a Therapeutic of the invention is administered to treat a nervous system disorder or to promote tissue regeneration and repair.
In one embodiment, Therapeutics which antagonize, r inhibit, Notch and/or Serrate function (hereinafter "Antagonist Therapeutics") are administered for therapeutic effect. In another embodiment, Therapeutics which promote Notch and/or Serrate function (hereinafter "Agonist Therapeutics") are administered for therapeutic effect.
Disorders of cell fate, in particular hyperproliferative (e.g., cancer) or hypoproliferative disorders, involving aberrant or undesirable levels of expression or activity or localization of Notch and/or Serrate protein can be diagnosed by detecting such levels, as described more fully infra.
In a preferred aspect, a Therapeutic of the invention is a protein consisting of at least a fragment (termed herein "adhesive fragment") of Serrate which mediates binding to a Notch protein or a fragment thereof.
The invention is illustrated by way of examples infra which disclose, inter alia, the cloning of D. melanogaster Serrate (Section 6); the construction and recombinant expression of a Serrate chimeric/fusion derivative and production of antibodies thereto (Section 7); the recombinant expression of Serrate, a Serrate fragment lacking the EGF-like repeats present in Serrate, and a chimeric Notch-Serrate derivative, and assays for binding to Notch (Section 8); the cloning of a mouse Serrate homolog (Section 9), the cloning of a Xenopus (frog) Serrate homolog (Section 10), the cloning of a chick Serrate homolog (Section 11), and the cloning of human Serrate homologs (Section 12).
For clarity of disclosure, and not by way of limitation, the detailed description of the invention is divided into the sub-sections which follow.
5.1. Isolation of the Serrate Genes
The invention relates to the nucleotide sequences of Serrate nucleic acids. In specific embodiments, Drosophila Serrate nucleic acids comprise the cDNA sequences shown in FIGS. 9A-9G (SEQ ID NO:5), FIGS. 10A-10D (SEQ ID NO:7), FIGS. 11A-11B (SEQ ID NO:9) or FIGS. 3A-3F (SEQ ID NO:1) or the coding regions thereof, or nucleic acids encoding a Serrate protein (e.g., having the sequence of SEQ ID NO:6, 8, 10, or 2). The invention provides nucleic acids consisting of at least 8 nucleotides (i.e., a hybridizable portion) of a Serrate sequence; in other embodiments, the nucleic acids consist of at least 25 (continuous) nucleotides, 50 nucleotides, 100 nucleotides, 150 nucleotides, or 200 nucleotides of a Serrate sequence, or a full-length Serrate coding sequence. The invention also relates to nucleic acids hybridizable to or complementary to the foregoing sequences. In specific aspects, nucleic acids are provided which comprise a sequence complementary to at least 10, 25, 50, 100, or 200 nucleotides or the entire coding region of a Serrate gene. In a specific embodiment, a nucleic acid which is hybridizable to a Serrate nucleic acid (e.g., having sequence SEQ ID NO:5), or to a nucleic acid encoding a Serrate derivative, under conditions of low stringency is provided. By way of example and not limitation, procedures using such conditions of low stringency are as follows (see also Shilo and Weinberg, 1981, Proc. Natl. Acad. Sci. USA 78:6789-6792): Filters containing DNA are pretreated for 6 h at 40.degree. C. in a solution containing 35% formamide, 5.times.SSC, 50 mM Tris-HCl (pH 7.5), 5 mM EDTA, 0.1% PVP, 0.1% Ficoll, 1% BSA, and 500 .mu.g/ml denatured salmon sperm DNA. Hybridizations are carried out in the same solution with the following modifications: 0.02% PVP, 0.02% Ficoll, 0.2% BSA, 100 .mu.g/ml salmon sperm DNA, 10% (wt/vol) dextran sulfate, and 5-20.times.10.sup.6 cpm .sup.32 P-labeled probe is used. Filters are incubated in hybridization mixture for 18-20 h at 40.degree. C., and then washed for 1.5 h at 55.degree. C. in a solution containing 2.times.SSC, 25 mM Tris-HCl (pH 7.4), 5 mM EDTA, and 0.1% SDS. The wash solution is replaced with fresh solution and incubated an additional 1.5 h at 60.degree. C. Filters are blotted dry and exposed for autoradiography. If necessary, filters are washed for a third time at 65.degree.-68.degree. C. and reexposed to film. Other conditions of low stringency which may be used are well known in the art (e.g., as employed for cross-species hybridizations).
In another specific embodiment, a nucleic acid which is hybridizable to a Serrate nucleic acid under conditions of high stringency is provided. By way of example and not limitation, procedures using such conditions of high stringency are as follows: Prehybridization of filters containing DNA is carried out for 8 h to overnight at 65.degree. C. in buffer composed of 6.times.SSC, 50 mM Tris-HCl (pH 7.5), 1 mM EDTA, 0.02% PVP, 0.02% Ficoll, 0.02% BSA, and 500 .mu.g/ml denatured salmon sperm DNA. Filters are hybridized for 48 h at 65.degree. C. in prehybridization mixture containing 100 .mu.g/ml denatured salmon sperm DNA and 5-20.times.10.sup.6 cpm of .sup.32 P-labeled probe. Washing of filters is done at 37.degree. C. for 1 h in a solution containing 2.times.SSC, 0.01% PVP, 0.01% Ficoll, and 0.01% BSA. This is followed by a wash in 0.1.times.SSC at 50.degree. C. for 45 min before autoradiography. Other conditions of high stringency which may be used are well known in the art.
Nucleic acids encoding fragments and derivatives of Serrate proteins (see Section 5.6), and Serrate antisense nucleic acids (see Section 5.11) are additionally provided. As is readily apparent, as used herein, a "nucleic acid encoding a fragment or portion of a Serrate protein" shall be construed as referring to a nucleic acid encoding only the recited fragment or portion of the Serrate protein and not the other contiguous portions of the Serrate protein as a continuous sequence.
Fragments of Serrate nucleic acids comprising regions of homology to other toporythmic proteins are also provided. For example, the region of homology with Delta spans nucleotides 627-1290 of SEQ ID NO:1. The DSL regions (regions of homology with Drosophila Delta and Serrate) of Serrate proteins of other species are also provided. Nucleic acids encoding conserved regions between Delta and Serrate, such as those represented by Serrate amino acids 63-73, 124-134, 149-158, 195-206, 214-219, and 250-259 of SEQ ID NO:2, or by the DSL domains, or by the sequences of SEQ ID NO:20, 14, or 12, are also provided.
Specific embodiments for the cloning of a Serrate gene, presented as a particular example but not by way of limitation, follows:
For expression cloning (a technique commonly known in the art), an expression library is constructed by methods known in the art. For example, mRNA (e.g., human) is isolated, cDNA is made and ligated into an expression vector (e.g., a bacteriophage derivative) such that it is capable of being expressed by the host cell into which it is then introduced. Various screening assays can then be used to select for the expressed Serrate product. In one embodiment, anti-Serrate antibodies can be used for selection.
In another preferred aspect, PCR is used to amplify the desired sequence in a genomic or cDNA library, prior to selection. Oligonucleotide primers representing known Serrate sequences can be used as primers in PCR. In a preferred aspect, the oligonucleotide primers represent at least part of the Serrate conserved segments of strong homology between Serrate and Delta. The synthetic oligonucleotides may be utilized as primers to amplify by PCR sequences from a source (RNA or DNA), preferably a cDNA library, of potential interest. PCR can be carried out, e.g., by use of a Perkin-Elmer Cetus thermal cycler and Taq polymerase (Gene Amp ). The DNA being amplified can include mRNA or cDNA or genomic DNA from any eukaryotic species. One can choose to synthesize several different degenerate primers, for use in the PCR reactions. It is also possible to vary the stringency of hybridization conditions used in priming the PCR reactions, to allow for greater or lesser degrees of nucleotide sequence similarity between the known Serrate nucleotide sequence and the nucleic acid homolog being isolated. For cross species hybridization, low stringency conditions are preferred. For same species hybridization, moderately stringent conditions are preferred. After successful amplification of a segment of a Serrate homolog, that segment may be molecularly cloned and sequenced, and utilized as a probe to isolate a complete cDNA or genomic clone. This, in turn, will permit the determination of the gene's complete nucleotide sequence, the analysis of its expression, and the production of its protein product for functional analysis, as described infra. In this fashion, additional genes encoding Serrate proteins may be identified. Such a procedure is presented by way of example in various examples sections infra.
The above-methods are not meant to limit the following general description of methods by which clones of Serrate may be obtained.
Any eukaryotic cell potentially can serve as the nucleic acid source for the molecular cloning of the Serrate gene. The nucleic acid sequences encoding Serrate can be isolated from human, porcine, bovine, feline, avian, equine, canine, as well as additional primate sources, insects, etc. For example, we have amplified fragments of the appropriate size in Drosophila, mouse, Xenopus, and human, by PCR using cDNA libraries with Drosophila Serrate primers. The DNA may be obtained by standard procedures known in the art from cloned DNA (e.g., a DNA "library"), by chemical synthesis, by cDNA cloning, or by the cloning of genomic DNA, or fragments thereof, purified from the desired cell. (See, for example, Sambrook et al., 1989, Molecular Cloning, A Laboratory Manual, 2d Ed., Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y.; Glover, D. M. (ed.), 1985, DNA Cloning: A Practical Approach, MRL Press, Ltd., Oxford, U.K. Vol. I, II.) Clones derived from genomic DNA may contain regulatory and intron DNA regions in addition to coding regions; clones derived from cDNA will contain only exon sequences. Whatever the source, the gene should be molecularly cloned into a suitable vector for propagation of the gene.
In the molecular cloning of the gene from genomic DNA, DNA fragments are generated, some of which will encode the desired gene. The DNA may be cleaved at specific sites using various restriction enzymes. Alternatively, one may use DNAse in the presence of manganese to fragment the DNA, or the DNA can be physically sheared, as for example, by sonication. The linear DNA fragments can then be separated according to size by standard techniques, including but not limited to, agarose and polyacrylamide gel electrophoresis and column chromatography.
Once the DNA fragments are generated, identification of the specific DNA fragment containing the desired gene may be accomplished in a number of ways. For example, if an amount of a portion of a Serrate (of any species) gene or its specific RNA, or a fragment thereof, e.g., an extracellular domain (see Section 5.6), is available and can be purified and labeled, the generated DNA fragments may be screened by nucleic acid hybridization to the labeled probe (Benton, W. and Davis, R., 1977, Science 196:180; Grunstein, M. And Hogness, D., 1975, Proc. Natl. Acad. Sci. U.S.A. 72:3961). Those DNA fragments with substantial homology to the probe will hybridize. It is also possible to identify the appropriate fragment by restriction enzyme digestion(s) and comparison of fragment sizes with those expected according to a known restriction map if such is available. Further selection can be carried out on the basis of the properties of the gene. Alternatively, the presence of the gene may be detected by assays based on the physical, chemical, or immunological properties of its expressed product. For example, cDNA clones, or DNA clones which hybrid-select the proper mRNAs, can be selected which produce a protein that, e.g., has similar or identical electrophoretic migration, isolectric focusing behavior, proteolytic digestion maps, receptor binding activity, in vitro aggregation activity ("adhesiveness") or antigenic properties as known for Serrate. If an antibody to Serrate is available, the Serrate protein may be identified by binding of labeled antibody to the putatively Serrate synthesizing clones, in an ELISA (enzyme-linked immunosorbent assay)-type procedure.
The Serrate gene can also be identified by mRNA selection by nucleic acid hybridization followed by in vitro translation. In this procedure, fragments are used to isolate complementary mRNAs by hybridization. Such DNA fragments may represent available, purified Serrate DNA of another species (e.g., Drosophila). Immunoprecipitation analysis or functional assays (e.g., aggregation ability in vitro; binding to receptor; see infra) of the in vitro translation products of the isolated products of the isolated mRNAs identifies the mRNA and, therefore, the complementary DNA fragments that contain the desired sequences. In addition, specific mRNAs may be selected by adsorption of polysomes isolated from cells to immobilized antibodies specifically directed against Serrate protein. A radiolabelled Serrate cDNA can be synthesized using the selected mRNA (from the adsorbed polysomes) as a template. The radiolabelled mRNA or cDNA may then be used as a probe to identify the Serrate DNA fragments from among other genomic DNA fragments.
Alternatives to isolating the Serrate genomic DNA include, but are not limited to, chemically synthesizing the gene sequence itself from a known sequence or making cDNA to the mRNA which encodes the Serrate protein. For example, RNA for cDNA cloning of the Serrate gene can be isolated from cells which express Serrate. Other methods are possible and within the scope of the invention.
The identified and isolated gene can then be inserted into an appropriate cloning vector. A large number of vector-host systems known in the art may be used. Possible vectors include, but are not limited to, plasmids or modified viruses, but the vector system must be compatible with the host cell used. Such vectors include, but are not limited to, bacteriophages such as lambda derivatives, or plasmids such as pB7322 or pUC plasmid derivatives. The insertion into a cloning vector can, for example, be accomplished by ligating the DNA fragment into a cloning vector which has complementary cohesive termini. However, if the complementary restriction sites used to fragment the DNA are not present in the cloning vector, the ends of the DNA molecules may be enzymatically modified. Alternatively, any site desired may be produced by ligating nucleotide sequences (linkers) onto the DNA termini; these ligated linkers may comprise specific chemically synthesized oligonucleotides encoding restriction endonuclease recognition sequences. In an alternative method, the cleaved vector and Serrate gene may be modified by homopolymeric tailing. Recombinant molecules can be introduced into host cells via transformation, transfection, infection, electroporation, etc., so that many copies of the gene sequence are generated.
In an alternative method, the desired gene may be identified and isolated after insertion into a suitable cloning vector in a "shot gun" approach. Enrichment for the desired gene, for example, by size fractionization, can be done before insertion into the cloning vector.
In specific embodiments, transformation of host cells with recombinant DNA molecules that incorporate the isolated Serrate gene, cDNA, or synthesized DNA sequence enables generation of multiple copies of the gene. Thus, the gene may be obtained in large quantities by growing transformants, isolating the recombinant DNA molecules from the transformants and, when necessary, retrieving the inserted gene from the isolated recombinant DNA.
The Serrate sequences provided by the instant invention include those nucleotide sequences encoding substantially the same amino acid sequences as found in native Serrate proteins, and those encoded amino acid sequences with functionally equivalent amino acids, all as described in Section 5.6 infra for Serrate derivatives.
5.2. Expression of the Serrate Genes
The nucleotide sequence coding for a Serrate protein or a functionally active fragment or other derivative thereof (see Section 5.6), can be inserted into an appropriate expression vector, i.e., a vector which contains the necessary elements for the transcription and translation of the inserted protein-coding sequence. The necessary transcriptional and translational signals can also be supplied by the native Serrate gene and/or its flanking regions. A variety of host-vector systems may be utilized to express the protein-coding sequence. These include but are not limited to mammalian cell systems infected with virus (e.g., vaccinia virus, adenovirus, etc.); insect cell systems infected with virus (e.g., baculovirus); microorganisms such as yeast containing yeast vectors, or bacteria transformed with bacteriophage, DNA, plasmid DNA, or cosmid DNA. The expression elements of vectors vary in their strengths and specificities. Depending on the host-vector system utilized, any one of a number of suitable transcription and translation elements may be used. In a specific embodiment, the adhesive portion of the Serrate gene is expressed. In other specific embodiments, the human Serrate gene is expressed, or a sequence encoding a functionally active portion of human Serrate. In yet another embodiment, a fragment of Serrate comprising the extracellular domain, or other derivative, or analog of Serrate is expressed.
Any of the methods previously described for the insertion of DNA fragments into a vector may be used to construct expression vectors containing a chimeric gene consisting of appropriate transcriptional/translational control signals and the protein coding sequences. These methods may include in vitro recombinant DNA and synthetic techniques and in vivo recombinants (genetic recombination). Expression of nucleic acid sequence encoding a Serrate protein or peptide fragment may be regulated by a second nucleic acid sequence so that the Serrate protein or peptide is expressed in a host transformed with the recombinant DNA molecule. For example, expression of a Serrate protein may be controlled by any promoter/enhancer element known in the art. Promoters which may be used to control toporythmic gene expression include, but are not limited to, the SV40 early promoter region (Bernoist and Chambon, 1981, Nature 290:304-310), the promoter contained in the 3' long terminal repeat of Rous sarcoma virus (Yamamoto, et al., 1980, Cell 22:787-797), the herpes thymidine kinase promoter (Wagner et al., 1981, Proc. Natl. Acad. Sci. U.S.A. 78:1441-1445), the regulatory sequences of the metallothionein gene (Brinster et al., 1982, Nature 296:39-42); prokaryotic expression vectors such as the .beta.-lactamase promoter (Villa-Kamaroff, et al., 1978, Proc. Natl. Acad. Sci. U.S.A. 75:3727-3731), or the tac promoter (DeBoer, et al., 1983, Proc. Natl. Acad. Sci. U.S.A. 80:21-25); see also "Useful proteins from recombinant bacteria" in Scientific American, 1980, 242:74-94; plant expression vectors comprising the nopaline synthetase promoter region (Herrera-Estrella et al., Nature 303:209-213) or the cauliflower mosaic virus 35S RNA promoter (Gardner, et al., 1981, Nucl. Acids Res. 9:2871), and the promoter of the photosynthetic enzyme ribulose biphosphate carboxylase (Herrera-Estrella et al., 1984, Nature 310:115-120); promoter elements from yeast or other fungi such as the Gal 4 promoter, the ADC (alcohol dehydrogenase) promoter, PGK (phosphoglycerol kinase) promoter, alkaline phosphatase promoter, and the following animal transcriptional control regions, which exhibit tissue specificity and have been utilized in transgenic animals: elastase I gene control region which is active in pancreatic acinar cells (Swift et al., 1984, Cell 38:639-646; Ornitz et al., 1986, Cold Spring Harbor Symp. Quant. Biol. 50:399-409; MacDonald, 1987, Hepatology 7:425-515); insulin gene control region which is active in pancreatic beta cells (Hanahan, 1985, Nature 315:115-122), immunoglobulin gene control region which is active in lymphoid cells (Grosschedl et al., 1984, Cell 38:647-658; Adames et al., 1985, Nature 318:533-538; Alexander et al., 1987, Mol. Cell. Biol. 7:1436-1444), mouse mammary tumor virus control region which is active in testicular, breast, lymphoid and mast cells (Leder et al., 1986, Cell 45:485-495), albumin gene control region which is active in liver (Pinkert et al., 1987, Genes and Devel. 1:268-276), alpha-fetoprotein gene control region which is active in liver (Krumlauf et al., 1985, Mol. Cell. Biol. 5:1639-1648; Hammer et al., 1987, Science 235:53-58; alpha 1-antitrypsin gene control region which is active in the liver (Kelsey et al., 1987, Genes and Devel. 1:161-171), beta-globin gene control region which is active in myeloid cells (Mogram et al., 1985, Nature 315:338-340; Kollias et al., 1986, Cell 46:89-94; myelin basic protein gene control region which is active in oligodendrocyte cells in the brain (Readhead et al., 1987, Cell 48:703-712); myosin light chain-2 gene control region which is active in skeletal muscle (Sani, 1985, Nature 314:283-286), and gonadotropic releasing hormone gene control region which is active in the hypothalamus (Mason et al., 1986, Science 234:1372-1378).
Expression vectors containing Serrate gene inserts can be identified by three general approaches: (a) nucleic acid hybridization, (b) presence or absence of "marker" gene functions, and (c) expression of inserted sequences. In the first approach, the presence of a foreign gene inserted in an expression vector can be detected by nucleic acid hybridization using probes comprising sequences that are homologous to an inserted toporythmic gene. In the second approach, the recombinant vector/host system can be identified and selected based upon the presence or absence of certain "marker" gene functions (e.g., thymidine kinase activity, resistance to antibiotics, transformation phenotype, occlusion body formation in baculovirus, etc.) caused by the insertion of foreign genes in the vector. For example, if the Serrate gene is inserted within the marker gene sequence of the vector, recombinants containing the Serrate insert can be identified by the absence of the marker gene function. In the third approach, recombinant expression vectors can be identified by assaying the foreign gene product expressed by the recombinant. Such assays can be based, for example, on the physical or functional properties of the Serrate gene product in vitro assay systems, e.g., aggregation (binding) with Notch, binding to a receptor, binding with antibody.
Once a particular recombinant DNA molecule is identified and isolated, several methods known in the art may be used to propagate it. Once a suitable host system and growth conditions are established, recombinant expression vectors can be propagated and prepared in quantity. As previously explained, the expression vectors which can be used include, but are not limited to, the following vectors or their derivatives: human or animal viruses such as vaccinia virus or adenovirus; insect viruses such as baculovirus; yeast vectors; bacteriophage vectors (e.g., lambda), and plasmid and cosmid DNA vectors, to name but a few.
In addition, a host cell strain may be chosen which modulates the expression of the inserted sequences, or modifies and processes the gene product in the specific fashion desired. Expression from certain promoters can be elevated in the presence of certain inducers; thus, expression of the genetically engineered Serrate protein may be controlled. Furthermore, different host cells have characteristic and specific mechanisms for the translational and post-translational processing and modification (e.g., glycosylation, cleavage e.g., of signal sequence!) of proteins. Appropriate cell lines or host systems can be chosen to ensure the desired modification and processing of the foreign protein expressed. For example, expression in a bacterial system can be used to produce an unglycosylated core protein product. Expression in yeast will produce a glycosylated product. Expression in mammalian cells can be used to ensure "native" glycosylation of a heterologous mammalian toporythmic protein. Furthermore, different vector/host expression systems may effect processing reactions such as proteolytic cleavages to different extents.
In other specific embodiments, the Serrate protein, fragment, analog, or derivative may be expressed as a fusion, or chimeric protein product (comprising the protein, fragment, analog, or derivative joined via a peptide bond to a heterologous protein sequence (of a different protein)). Such a chimeric product can be made by ligating the appropriate nucleic acid sequences encoding the desired amino acid sequences to each other by methods known in the art, in the proper coding frame, and expressing the chimeric product by methods commonly known in the art. Alternatively, such a chimeric product may be made by protein synthetic techniques, e.g., by use of a peptide synthesizer.
Both cDNA and genomic sequences can be cloned and expressed.
5.3. Identification and Purification of the Serrate Gene Products
In particular aspects, the invention provides amino acid sequences of Serrate, preferably human Serrate, and fragments and derivatives thereof which comprise an antigenic determinant (i.e., can be recognized by an antibody) or which are otherwise functionally active, as well as nucleic acid sequences encoding the foregoing. "Functionally active" material as used herein refers to that material displaying one or more known functional activities associated with a full-length (wild-type) Serrate protein, e.g., binding to Notch or a portion thereof, binding to any other Serrate ligand, antigenicity (binding to an anti-Serrate antibody), etc.
In specific embodiments, the invention provides fragments of a Serrate protein consisting of at least 6 amino acids, 10 amino acids, 50 amino acids, or of at least 75 amino acids. In other embodiments, the proteins comprise or consist essentially of an extracellular domain, DSL domain, epidermal growth factor-like repeat (ELR) domain, one or any combination of ELRs, cysteine-rich region, transmembrane domain, or intracellular (cytoplasmic) domain, or a portion which binds to Notch, or any combination of the foregoing, of a Serrate protein. Fragments, or proteins comprising fragments, lacking some or all of the foregoing regions of a Serrate protein are also provided. Nucleic acids encoding the foregoing are provided.
Once a recombinant which expresses the Serrate gene sequence is identified, the gene product can be analyzed. This is achieved by assays based on the physical or functional properties of the product, including radioactive labelling of the product followed by analysis by gel electrophoresis, immunoassay, etc.
Once the Serrate protein is identified, it may be isolated and purified by standard methods including chromatography (e.g., ion exchange, affinity, and sizing column chromatography), centrifugation, differential solubility, or by any other standard technique for the purification of proteins. The functional properties may be evaluated using any suitable assay (see Section 5.7).
Alternatively, once a Serrate protein produced by a recombinant is identified, the amino acid sequence of the protein can be deduced from the nucleotide sequence of the chimeric gene contained in the recombinant. As a result, the protein can be synthesized by standard chemical methods known in the art (e.g., see Hunkapiller, M., et al., 1984, Nature 310:105-111).
In a specific embodiment of the present invention, such Serrate proteins, whether produced by recombinant DNA techniques or by chemical synthetic methods, include but are not limited to those containing, as a primary amino acid sequence, all or part of the amino acid sequence substantially as depicted in FIGS. 3A-3F, 9A-9G, 10E or 12A-12B (SEQ ID NO:2, 6, 8, or 10, respectively), as well as fragments and other derivatives, and analogs thereof.
5.4. Structure of the Serrate Gene and Protein
The structure of the Serrate gene and protein can be analyzed by various methods known in the art.
5.4.1. Genetic Analysis
The cloned DNA or cDNA corresponding to the Serrate gene can be analyzed by methods including but not limited to Southern hybridization (Southern, E. M., 1975, J. Mol. Biol. 98:503-517), northern hybridization (see e.g., Freeman et al., 1983, Proc. Natl. Acad. Sci. U.S.A. 80:4094-4098), restriction endonuclease mapping (Maniatis, T., 1982, Molecular Cloning, A Laboratory, Cold Spring Harbor, N.Y.), and DNA sequence analysis. Polymerase chain reaction (PCR; U.S. Patent Nos. 4,683,202, 4,683,195 and 4,889,818; Gyllenstein et al., 1988, Proc. Natl. Acad. Sci. U.S.A. 85:7652-7656; Ochman et al., 1988, Genetics 120:621-623; Loh et al., 1989, Science 243:217-220) followed by Southern hybridization with a Serrate-specific probe can allow the detection of the Serrate gene in DNA from various cell types. Methods of amplification other than PCR are commonly known and can also be employed. In one embodiment, Southern hybridization can be used to determine the genetic linkage of Serrate. Northern hybridization analysis can be used to determine the expression of the Serrate gene. Various cell types, at various states of development or activity can be tested for Serrate expression. Examples of such techniques and their results are described in Section 6, infra. The stringency of the hybridization conditions for both Southern and Northern hybridization can be manipulated to ensure detection of nucleic acids with the desired degree of relatedness to the specific Serrate probe used.
Restriction endonuclease mapping can be used to roughly determine the genetic structure of the Serrate gene. In a particular embodiment, cleavage with restriction enzymes can be used to derive the restriction map shown in FIG. 2, infra. Restriction maps derived by restriction endonuclease cleavage can be confirmed by DNA sequence analysis.
DNA sequence analysis can be performed by any techniques known in the art, including but not limited to the method of Maxam and Gilbert (1980, Meth. Enzymol. 65:499-560), the Sanger dideoxy method (Sanger, F., et al., 1977, Proc. Natl. Acad. Sci. U.S.A. 74:5463), the use of T7 DNA polymerase (Tabor and Richardson, U.S. Pat. No. 4,795,699), or use of an automated DNA sequenator (e.g., Applied Biosystems, Foster City, Calif.). The cDNA sequence of a representative Serrate gene comprises the sequence substantially as depicted in FIGS. 9A-9G, and is described in Section 12, infra.
5.4.2. Protein Analysis
The amino acid sequence of the Serrate protein can be derived by deduction from the DNA sequence, or alternatively, by direct sequencing of the protein, e.g., with an automated amino acid sequencer. The amino acid sequence of a representative Serrate protein comprises the sequence substantially as depicted in FIGS. 3A-3F, and detailed in Section 6, infra, with the representative mature protein that shown by amino acid numbers 81-1404.
The Serrate protein sequence can be further characterized by a hydrophilicity analysis (Hopp, T. and Woods, K., 1981, Proc. Natl. Acad. Sci. U.S.A. 78:3824). A hydrophilicity profile can be used to identify the hydrophobic and hydrophilic regions of the Serrate protein and the corresponding regions of the gene sequence which encode such regions. A hydrophilicity profile of the Serrate protein described in the examples section infra is depicted in FIGS. 4A-4C.
Secondary, structural analysis (Chou, P. and Fasman, G., 1974, Biochemistry 13:222) can also be done, to identify regions of Serrate that assume specific secondary structures.
Manipulation, translation, and secondary structure prediction, as well as open reading frame prediction and plotting, can also be accomplished using computer software programs available in the art.
Other methods of structural analysis can also be employed. These include but are not limited to X-ray crystallography (Engstom, A., 1974, Biochem. Exp. Biol. 11:7-13) and computer modeling (Fletterick, R. and Zoller, M. (eds.), 1986, Computer Graphics and Molecular Modeling, in Current Communications in Molecular Biology, Cold Spring Harbor Laboratory, Cold Spring Harbor, N.Y.).
5.5. Generation of Antibodies to Serrate Proteins and Derivatives Thereof
According to the invention, Serrate protein, its fragments or other derivatives, or analogs thereof, may be used as an immunogen to generate antibodies which recognize such an immunogen. Such antibodies include but are not limited to polyclonal, monoclonal, chimeric, single chain, Fab fragments, and an Fab expression library. In a specific embodiment, antibodies to human Serrate are produced. In another embodiment, antibodies to the extracellular domain of Serrate are produced. In another embodiment, antibodies to the intracellular domain of Serrate are produced.
Various procedures known in the art may be used for the production of polyclonal antibodies to a Serrate protein or derivative or analog. In a particular embodiment, rabbit polyclonal antibodies to an epitope of the Serrate protein encoded by a sequence depicted in FIGS. 3A-3F, or a subsequence thereof, can be obtained. For the production of antibody, various host animals can be immunized by injection with the native Serrate protein, or a synthetic version, or derivative (e.g., fragment) thereof, including but not limited to rabbits, mice, rats, etc. Various adjuvants may be used to increase the immunological response, depending on the host species, and including but not limited to Freund's (complete and incomplete), mineral gels such as aluminum hydroxide, surface active substances such as lysolecithin, pluronic polyols, polyanions, peptides, oil emulsions, keyhole limpet hemocyanins, dinitrophenol, and potentially useful human adjuvants such as BCG (bacille Calmette-Guerin) and corynebacterium parvum.
For preparation of monoclonal antibodies directed toward a Serrate protein sequence or analog thereof, any technique which provides for the production of antibody molecules by continuous cell lines in culture may be used. For example, the hybridoma technique originally developed by Kohler and Milstein (1975, Nature 256:495-497), as well as the trioma technique, the human B-cell hybridoma technique (Kozbor et al., 1983, Immunology Today 4:72), and the EBV-hybridoma technique to produce human monoclonal antibodies (Cole et al., 1985, in Monoclonal Antibodies and Cancer Therapy, Alan R. Liss, Inc., pp. 77-96). In an additional embodiment of the invention, monoclonal antibodies can be produced in germ-free animals utilizing recent technology (PCT/US90/02545). According to the invention, human antibodies may be used and can be obtained by using human hybridomas (Cote et al., 1983, Proc. Natl. Acad. Sci. U.S.A. 80:2026-2030) or by transforming human B cells with EBV virus in vitro (Cole et al., 1985, in Monoclonal Antibodies and Cancer Therapy, Alan R. Liss, pp. 77-96). In fact, according to the invention, techniques developed for the production of "chimeric antibodies" (Morrison et al., 1984, Proc. Natl. Acad. Sci. U.S.A. 81:6851-6855; Neuberger et al., 1984, Nature 312:604-608; Takeda et al., 1985, Nature 314:452-454) by splicing the genes from a mouse antibody molecule specific for Serrate together with genes from a human antibody molecule of appropriate biological activity can be used; such antibodies are within the scope of this invention.
According to the invention, techniques described for the production of single chain antibodies (U.S. Pat. No. 4,946,778) can be adapted to produce Serrate-specific single chain antibodies. An additional embodiment of the invention utilizes the techniques described for the construction of Fab expression libraries (Huse et al., 1989, Science 246:1275-1281) to allow rapid and easy identification of monoclonal Fab fragments with the desired specificity for Serrate proteins, derivatives, or analogs.
Antibody fragments which contain the idiotype of the molecule can be generated by known techniques. For example, such fragments include but are not limited to: the F(ab').sub.2 fragment which can be produced by pepsin digestion of the antibody molecule; the Fab' fragments which can be generated by reducing the disulfide bridges of the F(ab').sub.2 fragment, and the Fab fragments which can be generated by treating the antibody molecule with papain and a reducing agent.
In the production of antibodies, screening for the desired antibody can be accomplished by techniques known in the art, e.g. ELISA (enzyme-linked immunosorbent assay). For example, to select antibodies which recognize a specific domain of a Serrate protein, one may assay generated hybridomas for a product which binds to a Serrate fragment containing such domain. For selection of an antibody specific to human Serrate, one can select on the basis of positive binding to human Serrate and a lack of binding to Drosophila Serrate.
The foregoing antibodies can be used in methods known in the art relating to the localization and activity of the protein sequences of the invention (e.g., see Section 5.7, infra), e.g., for imaging these proteins, measuring levels thereof in appropriate physiological samples, in diagnostic methods, etc.
Antibodies specific to a domain of a Serrate protein are also provided. In a specific embodiment, antibodies which bind to a Notch-binding fragment of Serrate are provided.
In another embodiment of the invention (see infra), anti-Serrate antibodies and fragments thereof containing the binding domain are Therapeutics.
5.6. Serrate Proteins. Derivatives and Analogs
The invention further relates to Serrate proteins, and derivatives (including but not limited to fragments) and analogs of Serrate proteins. Nucleic acids encoding Serrate protein derivatives and protein analogs are also provided. In one embodiment, the Serrate proteins are encoded by the Serrate nucleic acids described in Section 5.1 supra. In particular aspects, the proteins, derivatives, or analogs are of fly, frog, mouse, rat, pig, cow, dog, monkey, or human Serrate proteins.
The production and use of derivatives and analogs related to Serrate are within the scope of the present invention. In a specific embodiment, the derivative or analog is functionally active, i.e., capable of exhibiting one or more functional activities associated with a full-length, wild-type Serrate protein. As one example, such derivatives or analogs which have the desired immunogenicity or antigenicity can be used, for example, in immunoassays, for immunization, for inhibition of Serrate activity, etc. Such molecules which retain, or alternatively inhibit, a desired Serrate property, e.g., binding to Notch or other toporythmic proteins, binding to a cell-surface receptor, can be used as inducers, or inhibitors, respectively, of such property and its physiological correlates. A specific embodiment relates to a Serrate fragment that can be bound by an anti-Serrate antibody but cannot bind to a Notch protein or other toporythmic protein. Derivatives or analogs of Serrate can be tested for the desired activity by procedures known in the art, including but not limited to the assays described in Section 5.7.
In particular, Serrate derivatives can be made by altering Serrate sequences by substitutions, additions or deletions that provide for functionally equivalent molecules. Due to the degeneracy of nucleotide coding sequences, other DNA sequences which encode substantially the same amino acid sequence as a Serrate gene may be used in the practice of the present invention. These include but are not limited to nucleotide sequences comprising all or portions of Serrate genes which are altered by the substitution of different codons that encode a functionally equivalent amino acid residue within the sequence, thus producing a silent change. Likewise, the Serrate derivatives of the invention include, but are not limited to, those containing, as a primary amino acid sequence, all or part of the amino acid sequence of a Serrate protein including altered sequences in which functionally equivalent amino acid residues are substituted for residues within the sequence resulting in a silent change. For example, one or more amino acid residues within the sequence can be substituted by another amino acid of a similar polarity which acts as a functional equivalent, resulting in a silent alteration. Substitutes for an amino acid within the sequence may be selected from other members of the class to which the amino acid belongs. For example, the nonpolar (hydrophobic) amino acids include alanine, leucine, isoleucine, valine, proline, phenylalanine, tryptophan and methionine. The polar neutral amino acids include glycine, serine, threonine, cysteine, tyrosine, asparagine, and glutamine. The positively charged (basic) amino acids include arginine, lysine and histidine. The negatively charged (acidic) amino acids include aspartic acid and glutamic acid.
In a specific embodiment of the invention, proteins consisting of or comprising a fragment of a Serrate protein consisting of at least 10 (continuous) amino acids of the Serrate protein is provided. In other embodiments, the fragment consists of at least 20 or 50 amino acids of the Serrate protein. In specific embodiments, such fragments are not larger than 35, 100 or 200 amino acids. Derivatives or analogs of Serrate include but are not limited to those peptides which are substantially homologous to Serrate or fragments thereof (e.g., at least 30% identity over an amino acid sequence of identical size) or whose encoding nucleic acid is capable of hybridizing to a coding Serrate sequence.
The Serrate derivatives and analogs of the invention can be produced by various methods known in the art. The manipulations which result in their production can occur at the gene or protein level. For example, the cloned Serrate gene sequence can be modified by any of numerous strategies known in the art (Maniatis, T., 1990, Molecular Cloning, A Laboratory Manual, 2d ed., Cold Spring Harbor Laboratory, Cold Spring Harbor, N.Y.). The sequence can be cleaved at appropriate sites with restriction endonuclease(s), followed by further enzymatic modification if desired, isolated, and ligated in vitro. In the production of the gene encoding a derivative or analog of Serrate, care should be taken to ensure that the modified gene remains within the same translational reading frame as Serrate, uninterrupted by translational stop signals, in the gene region where the desired Serrate activity is encoded.
Additionally, the Serrate-encoding nucleic acid sequence can be mutated in vitro or in vivo, to create and/or destroy translation, initiation, and/or termination sequences, or to create variations in coding regions and/or form new restriction endonuclease sites or destroy preexisting ones, to facilitate further in vitro modification. Any technique for mutagenesis known in the art can be used, including but not limited to, in vitro site-directed mutagenesis (Hutchinson, C., et al., 1978, J. Biol. Chem 253:6551), use of TAB.RTM. linkers (Pharmacia), etc.
Manipulations of the Serrate sequence may also be made at the protein level. Included within the scope of the invention are Serrate protein fragments or other derivatives or analogs which are differentially modified during or after translation, e.g., by glycosylation, acetylation, phosphorylation, amidation, derivatization by known protecting/blocking groups, proteolytic cleavage, linkage to an antibody molecule or other cellular ligand, etc. Any of numerous chemical modifications may be carried out by known techniques, including but not limited to specific chemical cleavage by cyanogen bromide, trypsin, chymotrypsin, papain, V8 protease, NaBH.sub.4 ; acetylation, formylation, oxidation, reduction; metabolic synthesis in the presence of tunicamycin; etc.
In addition, analogs and derivatives of Serrate can be chemically synthesized. For example, a peptide corresponding to a portion of a Serrate protein which comprises the desired domain (see Section 5.6.1), or which mediates the desired aggregation activity in vitro, or binding to a receptor, can be synthesized by use of a peptide synthesizer. Furthermore, if desired, nonclassical amino acids or chemical amino acid analogs can be introduced as a substitution or addition into the Serrate sequence. Non-classical amino acids include but are not limited to the D-isomers of the common amino acids, a-amino isobutyric acid, 4-aminobutyric acid, hydroxyproline, sarcosine, citrulline, cysteic acid, t-butylglycine, t-butylalanine, phenylglycine, cyclohexylalanine, .beta.-alanine, designer amino acids such as .beta.-methyl amino acids, C.alpha.-methyl amino acids, and N.beta.-methyl amino acids.
In a specific embodiment, the Serrate derivative is a chimeric, or fusion, protein comprising a Serrate protein or fragment thereof (preferably consisting of at least a domain or motif of the Serrate protein, or at least 10 amino acids of the Serrate protein) joined at its amino- or carboxy-terminus via a peptide bond to an amino acid sequence of a different protein. In one embodiment, such a chimeric protein is produced by recombinant expression of a nucleic acid encoding the protein (comprising a Serrate-coding sequence joined in-frame to a coding sequence for a different protein). Such a chimeric product can be made by ligating the appropriate nucleic acid sequences encoding the desired amino acid sequences to each other by methods known in the art, in the proper coding frame, and expressing the chimeric product by methods commonly known in the art. Alternatively, such a chimeric product may be made by protein synthetic techniques, e.g., by use of a peptide synthesizer. In a specific embodiment, a chimeric nucleic acid encoding a mature Serrate protein with a heterologous signal sequence is expressed such that the chimeric protein is expressed and processed by the cell to the mature Serrate protein. As another example, and not by way of limitation, a recombinant molecule can be constructed according to the invention, comprising coding portions of both Serrate and another toporythmic gene, e.g., Delta. The encoded protein of such a recombinant molecule could exhibit properties associated with both Serrate and Delta and portray a novel profile of biological activities, including agonists as well as antagonists. The primary sequence of Serrate and Delta may also be used to predict tertiary structure of the molecules using computer simulation (Hopp and Woods, 1981, Proc. Natl.
Acad. Sci. U.S.A. 78:3824-3828); Serrate/Delta chimeric recombinant genes could be designed in light of correlations between tertiary structure and biological function. Likewise, chimeric genes comprising portions of Serrate fused to any heterologous protein-encoding sequences may be constructed. A specific embodiment relates to a chimeric protein comprising a fragment of Serrate of at least six amino acids. A particular example of the construction and expression of a Notch-Serrate chimera is presented in Section 8 hereof. A particular example of another Serrate fusion protein is presented in Section 7 hereof.
In another specific embodiment, the Serrate derivative is a fragment of Serrate comprising a region of homology with another toporythmic protein. As used herein, a region of a first protein shall be considered "homologous" to a second protein when the amino acid sequence of the region is at least 30% identical or at least 75% either identical or involving conservative changes, when compared to any sequence in the second protein of an equal number of amino acids as the number contained in the region. For example, such a Serrate fragment can comprise one or more regions homologous to Delta, including but not limited to Drosophila Serrate amino acids 63-73, 124-134, 149-158, 195-206, 214-219, 250-259, or 79-282 (or 79-246, excluding the partial EGF-like repeat) (see FIGS. 3A-3F, 7), or portions of Serrate of other species most homologous to the foregoing sequences, or DSL domains or portions thereof.
Other specific embodiments of derivatives and analogs are described in the subsections below and examples sections infra.
5.6.1. Derivatives of Serrate Containing One or More Domains of the Protein
In a specific embodiment, the invention relates to Serrate derivatives and analogs, in particular Serrate fragments and derivatives of such fragments, that comprise, or alternatively consist of, one or more domains of the Serrate protein, including but not limited to the extracellular domain, DSL domain, ELR domain, cysteine rich domain, transmembrane domain, intracellular domain, membrane-associated region, and one or more of the EGF-like repeats (ELR) of the Serrate protein, or any combination of the foregoing. In particular examples relating to the human and chick Serrate proteins, such domains are identified in Examples Section 12 and 11, respectively. In particular examples relating to the Drosophila Serrate protein (see example 6), such domains are identified as follows, with reference to FIGS. 3A-3F: extracellular domain, amino acids numbers (AA) 81-541; transmembrane domain, AA 1221-1245; intracellular domain, AA 1246-1404; membrane-associated region, AA 542-564; ELR (see underscored sequences in FIGS. 3A-3F).
In a specific embodiment, relating to a Serrate protein of a species other than D. melanogaster, the molecules comprising specific fragments of Serrate are those comprising fragments in the respective Serrate protein most homologous to specific fragments of the Drosophila Serrate and/or Delta proteins. In particular embodiments, such a molecule comprises or consists of the amino acid sequences of SEQ ID NO:12, 14 or 20. Alternatively, a fragment comprising a domain of a Serrate homolog can be identified by protein analysis methods as described in Section 5.3.2 or 6.
Serrate derivatives which are Serrate fragments and chimeric/fusion proteins are described by way of example in Sections 7 and 8 infra.
5.6.2. Derivatives of Serrate That Mediate Binding to Toporythmic Protein Domains
The invention also provides for Serrate fragments, and analogs or derivatives of such fragments, which mediate binding to toporythmic proteins (and thus are termed herein "adhesive"), and nucleic acid sequences encoding the foregoing.
In a specific embodiment, the adhesive fragment of Serrate is that comprising the portion of Serrate most homologous to about amino acid numbers 85-283 or 79-282 of the Drosophila Serrate sequence (see FIGS. 3A-3F).
In a particular embodiment, the adhesive fragment of a Serrate protein comprises the DSL domain, or a portion thereof. Subfragments within the DSL domain that mediate binding to Notch can be identified by analysis of constructs expressing deletion mutants.
The ability to bind to a toporythmic protein (preferably Notch) can be demonstrated by in vitro aggregation assays with cells expressing such a toporythmic protein as well as cells expressing Serrate or a Serrate derivative (See Section 5.7). That is, the ability of a Serrate fragment to bind to a Notch protein can be demonstrated by detecting the ability of the Serrate fragment, when expressed on the surface of a first cell, to bind to a Notch protein expressed on the surface of a second cell.
The nucleic acid sequences encoding toporythmic proteins or adhesive domains thereof, for use in such assays, can be isolated from human, porcine, bovine, feline, avian, equine, canine, or insect, as well as primate sources and any other species in which homologs of known toporythmic genes can be identified.
5.7. Assays of Serrate Proteins, Derivatives and Analogs
The functional activity of Serrate proteins, derivatives and analogs can be assayed by various methods.
For example, in one embodiment, where one is assaying for the ability to bind or compete with wild-type Serrate for binding to anti-Serrate antibody, various immunoassays known in the art can be used, including but not limited to competitive and non-competitive assay systems using techniques such as radioimmunoassays, ELISA (enzyme linked immunosorbent assay), "sandwich" immunoassays, immunoradiometric assays, gel diffusion precipitin reactions, immunodiffusion assays, in situ immunoassays (using colloidal gold, enzyme or radioisotope labels, for example), western blots, precipitation reactions, agglutination assays (e.g., gel agglutination assays, hemagglutination assays), complement fixation assays, immunofluorescence assays, protein A assays, and immunoelectrophoresis assays, etc. In one embodiment, antibody binding is detected by detecting a label on the primary antibody. In another embodiment, the primary antibody is detected by detecting binding of a secondary antibody or reagent to the primary antibody. In a further embodiment, the secondary antibody is labelled. Many means are known in the art for detecting binding in an immunoassay and are within the scope of the present invention.
In another embodiment, where one is assaying for the ability to mediate binding to a toporythmic protein, e.g., Notch, one can carry out an in vitro aggregation assay such as described infra in Section 8.2.1 (see also Fehon et al., 1990, Cell 61:523-534; Rebay et al., 1991, Cell 67:687-699).
In another embodiment, where a receptor for Serrate is identified, receptor binding can be assayed, e.g., by means well-known in the art. In another embodiment, physiological correlates of Serrate binding to cells expressing a Serrate receptor (signal transduction) can be assayed.
In another embodiment, in insect or other model systems, genetic studies can be done to study the phenotypic effect of a Serrate mutant that is a derivative or analog of wild-type Serrate (see Section 6, infra).
Other methods will be known to the skilled artisan and are within the scope of the invention.
5.8. Therapeutic Uses
The invention provides for treatment of disorders of cell fate or differentiation by administration of a therapeutic compound of the invention. Such therapeutic compounds (termed herein "Therapeutics") include: Serrate proteins and analogs and derivatives (including fragments) thereof (e.g., as described hereinabove); antibodies thereto (as described hereinabove); nucleic acids encoding the Serrate proteins, analogs, or derivatives (e.g., as described hereinabove); and Serrate antisense nucleic acids. As stated supra, the Antagonist Therapeutics of the invention are those Therapeutics which antagonize, or inhibit, a Serrate function and/or Notch function (since Serrate is a Notch ligand). Such Antagonist Therapeutics are most preferably identified by use of known convenient in vitro assays, e.g., based on their ability to inhibit binding of Serrate to another protein (e.g., a Notch protein), or inhibit any known Notch or Serrate function as preferably assayed in vitro or in cell culture, although genetic assays (e.g., in Drosophila) may also be employed. In a preferred embodiment, the Antagonist Therapeutic is a protein or derivative thereof comprising a functionally active fragment such as a fragment of Serrate which mediates binding to Notch, or an antibody thereto. In other specific embodiments, such an Antagonist Therapeutic is a nucleic acid capable of expressing a molecule comprising a fragment of Serrate which binds to Notch, or a Serrate antisense nucleic acid (see Section 5.11 herein). It should be noted that preferably, suitable in vitro or in vivo assays, as described infra, should be utilized to determine the effect of a specific Therapeutic and whether its administration is indicated for treatment of the affected tissue, since the developmental history of the tissue may determine whether an Antagonist or Agonist Therapeutic is desired.
In addition, the mode of administration, e.g., whether administered in soluble form or administered via its encoding nucleic acid for intracellular recombinant expression, of the Serrate protein or derivative can affect whether it acts as an agonist or antagonist.
In another embodiment of the invention, a nucleic acid containing a portion of a Serrate gene is used, as an Antagonist Therapeutic, to promote Serrate inactivation by homologous recombination (Koller and Smithies, 1989, Proc. Natl. Acad. Sci. USA 86:8932-8935; Zijlstra et al., 1989, Nature 342:435-438).
The Agonist Therapeutics of the invention, as described supra, promote Serrate function. Such Agonist Therapeutics include but are not limited to proteins and derivatives comprising the portions of Notch that mediate binding to Serrate, and nucleic acids encoding the foregoing (which can be administered to express their encoded products in vivo).
Further descriptions and sources of Therapeutics of the inventions are found in Sections 5.1 through 5.7 herein.
Molecules which retain, or alternatively inhibit, a desired Serrate property, e.g., binding to Notch, binding to an intracellular ligand, can be used therapeutically as inducers, or inhibitors, respectively, of such property and its physiological correlates. In a specific embodiment, a peptide (e.g., in the range of 6-50 or 15-25 amino acids; and particularly of about 10, 15, 20 or 25 amino acids) containing the sequence of a portion of Serrate which binds to Notch is used to antagonize Notch function. In a specific embodiment, such an Antagonist Therapeutic is used to treat or prevent human or other malignancies associated with increased Notch expression (e.g., cervical cancer, colon cancer, breast cancer, squamous adenocarcimas (see infra)). Derivatives or analogs of Serrate can be tested for the desired activity by procedures known in the art, including but not limited to the assays described in the examples infra. For example, molecules comprising Serrate fragments which bind to Notch EGF-repeats (ELR) 11 and 12 and which are smaller than a DSL domain, can be obtained and selected by expressing deletion mutants and assaying for binding of the expressed product to Notch by any of the several methods (e.g., in vitro cell aggregation assays, interaction trap system), some of which are described in the Examples Sections infra. In one specific embodiment, peptide libraries can be screened to select a peptide with the desired activity; such screening can be carried out by assaying, e.g., for binding to Notch or a molecule containing the Notch ELR 11 and 12 repeats.
The Agonist and Antagonist Therapeutics of the invention have therapeutic utility for disorders of cell fate. The Agonist Therapeutics are administered therapeutically (including prophylactically): (1) in diseases or disorders involving an absence or decreased (relative to normal, or desired) levels of Notch or Serrate function, for example, in patients where Notch or Serrate protein is lacking, genetically defective, biologically inactive or underactive, or underexpressed; and (2) in diseases or disorders wherein in vitro (or in vivo) assays (see infra) indicate the utility of Serrate agonist administration. The absence or decreased levels in Notch or Serrate function can be readily detected, e.g., by obtaining a patient tissue sample (e.g., from biopsy tissue) and assaying it in vitro for protein levels, structure and/or activity of the expressed Notch or Serrate protein. Many methods standard in the art can be thus employed, including but not limited to immunoassays to detect and/or visualize Notch or Serrate protein (e.g., Western blot, immunoprecipitation followed by sodium dodecyl sulfate polyacrylamide gel electrophoresis, immunocytochemistry, etc.) and/or hybridization assays to detect Notch or Serrate expression by detecting and/or visualizing respectively Notch or Serrate mRNA (e.g., Northern assays, dot blots, in situ hybridization, etc.)
In vitro assays which can be used to determine whether administration of a specific Agonist Therapeutic or Antagonist Therapeutic is indicated, include in vitro cell culture assays in which a patient tissue sample is grown in culture, and exposed to or otherwise administered a Therapeutic, and the effect of such Therapeutic upon the tissue sample is observed. In one embodiment, where the patient has a malignancy, a sample of cells from such malignancy is plated out or grown in culture, and the cells are then exposed to a Therapeutic. A Therapeutic which inhibits survival or growth of the malignant cells (e.g., by promoting terminal differentiation) is selected for therapeutic use in vivo. Many assays standard in the art can be used to assess such survival and/or growth; for example, cell proliferation can be assayed by measuring .sup.3 H-thymidine incorporation, by direct cell count, by detecting changes in transcriptional activity of known genes such as proto-oncogenes (e.g., fos, myc) or cell cycle markers; cell viability can be assessed by trypan blue staining, differentiation can be assessed visually based on changes in morphology, etc. In a specific aspect, the malignant cell cultures are separately exposed to (1) an Agonist Therapeutic, and (2) an Antagonist Therapeutic; the result of the assay can indicate which type of Therapeutic has therapeutic efficacy.
In another embodiment, a Therapeutic is indicated for use which exhibits the desired effect, inhibition or promotion of cell growth, upon a patient cell sample from tissue having or suspected of having a hyper- or hypoproliferative disorder, respectively. Such hyper- or hypoproliferative disorders include but are not limited to those described in Sections 5.8.1 through 5.8.3 infra.
In another specific embodiment, a Therapeutic is indicated for use in treating nerve injury or a nervous system degenerative disorder (see Section 5.8.2) which exhibits in vitro promotion of nerve regeneration/neurite extension from nerve cells of the affected patient type.
In addition, administration of an Antagonist Therapeutic of the invention is also indicated in diseases or disorders determined or known to involve a Notch or Serrate dominant activated phenotype ("gain of function" mutations.) Administration of an Agonist Therapeutic is indicated in diseases or disorders determined or known to involve a Notch or Serrate dominant negative phenotype ("loss of function" mutations). The functions of various structural domains of the Notch protein have been investigated in vivo, by ectopically expressing a series of Drosophila Notch deletion mutants under the hsp7o heat-shock promoter, as well as eye-specific promoters (see Rebay et al., 1993, Cell 74:319-329). Two classes of dominant phenotypes were observed, one suggestive of Notch loss-of function mutations and the other of Notch gain-of-function mutations. Dominant "activated" phenotypes resulted from overexpression of a protein lacking most extracellular sequences, while dominant "negative" phenotypes resulted from overexpression of a protein lacking most intracellular sequences. The results indicated that Notch functions as a receptor whose extracellular domain mediates ligand-binding, resulting in the transmission of developmental signals by the cytoplasmic domain. We have shown that Serrate binds to the Notch ELR 11 and 12 (see Section 8 infra).
In various specific embodiments, in vitro assays can be carried out with representative cells of cell types involved in a patient's disorder, to determine if a Therapeutic has a desired effect upon such cell types.
In another embodiment, cells of a patient tissue sample suspected of being pre-neoplastic are similarly plated out or grown in vitro, and exposed to a Therapeutic. The Therapeutic which results in a cell phenotype that is more normal (i.e., less representative of a pre-neoplastic state, neoplastic state, malignant state, or transformed phenotype) is selected for therapeutic use. Many assays standard in the art can be used to assess whether a pre-neoplastic state, neoplastic state, or a transformed or malignant phenotype, is present. For example, characteristics associated with a transformed phenotype (a set of in vitro characteristics associated with a tumorigenic ability in vivo) include a more rounded cell morphology, looser substratum attachment, loss of contact inhibition, loss of anchorage dependence, release of proteases such as plasminogen activator, increased sugar transport, decreased serum requirement, expression of fetal antigens, disappearance of the 250,000 dalton surface protein, etc. (see Luria et al., 1978, General Virology, 3d Ed., John Wiley & Sons, New York pp. 436-446).
In other specific embodiments, the in vitro assays described supra can be carried out using a cell line, rather than a cell sample derived from the specific patient to be treated, in which the cell line is derived from or displays characteristic(s) associated with the malignant, neoplastic or pre-neoplastic disorder desired to be treated or prevented, or is derived from the neural or other cell type upon which an effect is desired, according to the present invention.
The Antagonist Therapeutics are administered therapeutically (including prophylactically): (1) in diseases or disorders involving increased (relative to normal, or desired) levels of Notch or Serrate function, for example, where the Notch or Serrate protein is overexpressed or overactive; and (2) in diseases or disorders wherein in vitro (or in vivo) assays indicate the utility of Serrate antagonist administration. The increased levels of Notch or Serrate function can be readily detected by methods such as those described above, by quantifying protein and/or RNA. In vitro assays with cells of patient tissue sample or the appropriate cell line or cell type, to determine therapeutic utility, can be carried out as described above.
5.8.1. Malignancies
Malignant and pre-neoplastic conditions which can be tested as described supra for efficacy of intervention with Antagonist or Agonist Therapeutics, and which can be treated upon thus observing an indication of therapeutic utility, include but are not limited to those described below in Sections 5.8.1 and 5.9.1.
Malignancies and related disorders, cells of which type can be tested in vitro (and/or in vivo), and upon observing the appropriate assay result, treated according to the present invention, include but are not limited to those listed in Table 1 (for a review of such disorders, see Fishman et al., 1985, Medicine, 2d Ed., J. B. Lippincott Co., Philadelphia):
In specific embodiments, malignancy or dysproliferative changes (such as metaplasias and dysplasias) are treated or prevented in epithelial tissues such as those in the cervix, esophagus, and lung.
Malignancies of the colon and cervix exhibit increased expression of human Notch relative to such non-malignant tissue (see PCT Publication no. WO 94/07474 published Apr. 14, 1994, incorporated by reference herein in its entirety). Thus, in specific embodiments, malignancies or premalignant changes of the colon or cervix are treated or prevented by administering an effective amount of an Antagonist Therapeutic, e.g., a Serrate derivative, that antagonizes Notch function. The presence of increased Notch expression in colon, and cervical cancer suggests that many more cancerous and hyperproliferative conditions exhibit upregulated Notch. Thus, in specific embodiments, various cancers, e.g., breast cancer, squamous adenocarcinoma, seminoma, melanoma, and lung cancer, and premalignant changes therein, as well as other hyperproliferative disorders, can be treated or prevented by administration of an Antagonist Therapeutic that antagonizes Notch function.
5.8.2. Nervous System Disorders
Nervous system disorders, involving cell types which can be tested as described supra for efficacy of intervention with Antagonist or Agonist Therapeutics, and which can be treated upon thus observing an indication of therapeutic utility, include but are not limited to nervous system injuries, and diseases or disorders which result in either a disconnection of axons, a diminution or degeneration of neurons, or demyelination. Nervous system lesions which may be treated in a patient (including human and non-human mammalian patients) according to the invention include but are not limited to the following lesions of either the central (including spinal cord, brain) or peripheral nervous systems:
(i) traumatic lesions, including lesions caused by physical injury or associated with surgery, for example, lesions which sever a portion of the nervous system, or compression injuries;
(ii) ischemic lesions, in which a lack of oxygen in a portion of the nervous system results in neuronal injury or death, including cerebral infarction or ischemia, or spinal cord infarction or ischemia;
(iii) malignant lesions, in which a portion of the nervous system is destroyed or injured by malignant tissue which is either a nervous system associated malignancy or a malignancy derived from non-nervous system tissue;
(iv) infectious lesions, in which a portion of the nervous system is destroyed or injured as a result of infection, for example, by an abscess or associated with infection by human immunodeficiency virus, herpes zoster, or herpes simplex virus or with Lyme disease, tuberculosis, syphilis;
(v) degenerative lesions, in which a portion of the nervous system is destroyed or injured as a result of a degenerative process including but not limited to degeneration associated with Parkinson's disease, Alzheimer's disease, Huntington's chorea, or amyotrophic lateral sclerosis;
(vi) lesions associated with nutritional diseases or disorders, in which a portion of the nervous system is destroyed or injured by a nutritional disorder or disorder of metabolism including but not limited to, vitamin B12 deficiency, folic acid deficiency, Wernicke disease, tobacco-alcohol amblyopia, Marchiafava-Bignami disease (primary degeneration of the corpus callosum), and alcoholic cerebellar degeneration;
(vii) neurological lesions associated with systemic diseases including but not limited to diabetes (diabetic neuropathy, Bell's palsy), systemic lupus erythematosus, carcinoma, or sarcoidosis;
(viii) lesions caused by toxic substances including alcohol, lead, or particular neurotoxins; and
(ix) demyelinated lesions in which a portion of the nervous system is destroyed or injured by a demyelinating disease including but not limited to multiple sclerosis, human immunodeficiency virus-associated myelopathy, transverse myelopathy or various etiologies, progressive multifocal leukoencephalopathy, and central pontine myelinolysis.
Therapeutics which are useful according to the invention for treatment of a nervous system disorder may be selected by testing for biological activity in promoting the survival or differentiation of neurons (see also Section 5.8). For example, and not by way of limitation, Therapeutics which elicit any of the following effects may be useful according to the invention:
(i) increased survival time of neurons in culture;
(ii) increased sprouting of neurons in culture or in vivo;
(iii) increased production of a neuron-associated molecule in culture or in vivo, e.g., choline acetyltransferase or acetylcholinesterase with respect to motor neurons; or
(iv) decreased symptoms of neuron dysfunction in vivo.
Such effects may be measured by any method known in the art. In preferred, non-limiting embodiments, increased survival of neurons may be measured by the method set forth in Arakawa et al. (1990, J. Neurosci. 10:3507-3515); increased sprouting of neurons may be detected by methods set forth in Pestronk et al. (1980, Exp. Neurol. 70:65-82) or Brown et al. (1981, Ann. Rev. Neurosci. 4:17-42); increased production of neuron-associated molecules may be measured by bioassay, enzymatic assay, antibody binding, Northern blot assay, etc., depending on the molecule to be measured; and motor neuron dysfunction may be measured by assessing the physical manifestation of motor neuron disorder, e.g., weakness, motor neuron conduction velocity, or functional disability.
In a specific embodiments, motor neuron disorders that may be treated according to the invention include but are not limited to disorders such as infarction, infection, exposure to toxin, trauma, surgical damage, degenerative disease or malignancy that may affect motor neurons as well as other components of the nervous system, as well as disorders that selectively affect neurons such as amyotrophic lateral sclerosis, and including but not limited to progressive spinal muscular atrophy, progressive bulbar palsy, primary lateral sclerosis, infantile and juvenile muscular atrophy, progressive bulbar paralysis of childhood (Fazio-Londe syndrome), poliomyelitis and the post polio syndrome, and Hereditary Motorsensory Neuropathy (Charcot-Marie-Tooth Disease).
5.8.3. Tissue Repair and Regeneration
In another embodiment of the invention, a Therapeutic of the invention is used for promotion of tissue regeneration and repair, including but not limited to treatment of benign dysproliferative disorders. Specific embodiments are directed to treatment of cirrhosis of the liver (a condition in which scarring has overtaken normal liver regeneration processes), treatment of keloid (hypertrophic scar) formation (disfiguring of the skin in which the scarring process interferes with normal renewal), psoriasis (a common skin condition characterized by excessive proliferation of the skin and delay in proper cell fate determination), and baldness (a condition in which terminally differentiated hair follicles (a tissue rich in Notch) fail to function properly). In another embodiment, a Therapeutic of the invention is used to treat degenerative or traumatic disorders of the sensory epithelium of the inner ear.
5.9. Prophylactic Uses
5.9.1. Malignancies
The Therapeutics of the invention can be administered to prevent progression to a neoplastic or malignant state, including but not limited to those disorders listed in Table 1. Such administration is indicated where the Therapeutic is shown in assays, as described supra, to have utility for treatment or prevention of such disorder. Such prophylactic use is indicated in conditions known or suspected of preceding progression to neoplasia or cancer, in particular, where non-neoplastic cell growth consisting of hyperplasia, metaplasia, or most particularly, dysplasia has occurred (for review of such abnormal growth conditions, see Robbins and Angell, 1976, Basic Pathology, 2d Ed., W. B. Saunders Co., Philadelphia, pp. 68-79.) Hyperplasia is a form of controlled cell proliferation involving an increase in cell number in a tissue or organ, without significant alteration in structure or function. As but one example, endometrial hyperplasia often precedes endometrial cancer. Metaplasia is a form of controlled cell growth in which one type of adult or fully differentiated cell substitutes for another type of adult cell. Metaplasia can occur in epithelial or connective tissue cells. Atypical metaplasia involves a somewhat disorderly metaplastic epithelium. Dysplasia is frequently a forerunner of cancer, and is found mainly in the epithelia; it is the most disorderly form of non-neoplastic cell growth, involving a loss in individual cell uniformity and in the architectural orientation of cells. Dysplastic cells often have abnormally large, deeply stained nuclei, and exhibit pleomorphism. Dysplasia characteristically occurs where there exists chronic irritation or inflammation, and is often found in the cervix, respiratory passages, oral cavity, and gall bladder.
Alternatively or in addition to the presence of abnormal cell growth characterized as hyperplasia, metaplasia, or dysplasia, the presence of one or more characteristics of a transformed phenotype, or of a malignant phenotype, displayed in vivo or displayed in vitro by a cell sample from a patient, can indicate the desirability of prophylactic/therapeutic administration of a Therapeutic of the invention. As mentioned supra, such characteristics of a transformed phenotype include morphology changes, looser substratum attachment, loss of contact inhibition, loss of anchorage dependence, protease release, increased sugar transport, decreased serum requirement, expression of fetal antigens, disappearance of the 250,000 dalton cell surface protein, etc. (see also id., at pp. 84-90 for characteristics associated with a transformed or malignant phenotype).
In a specific embodiment, leukoplakia, a benign-appearing hyperplastic or dysplastic lesion of the epithelium, or Bowen's disease, a carcinoma in situ, are pre-neoplastic lesions indicative of the desirability of prophylactic intervention.
In another embodiment, fibrocystic disease (cystic hyperplasia, mammary dysplasia, particularly adenosis (benign epithelial hyperplasia)) is indicative of the desirability of prophylactic intervention.
In other embodiments, a patient which exhibits one or more of the following predisposing factors for malignancy is treated by administration of an effective amount of a Therapeutic: a chromosomal translocation associated with a malignancy (e.g., the Philadelphia chromosome for chronic myelogenous leukemia, t(14;18) for follicular lymphoma, etc.), familial polyposis or Gardner's syndrome (possible forerunners of colon cancer), benign monoclonal gammopathy (a possible forerunner of multiple myeloma), and a first degree kinship with persons having a cancer or precancerous disease showing a Mendelian (genetic) inheritance pattern (e.g., familial polyposis of the colon, Gardner's syndrome, hereditary exostosis, polyendocrine adenomatosis, medullary thyroid carcinoma with amyloid production and pheochromocytoma, Peutz-Jeghers syndrome, neurofibromatosis of Von Recklinghausen, retinoblastoma, carotid body tumor, cutaneous melanocarcinoma, intraocular melanocarcinoma, xeroderma pigmentosum, ataxia telangiectasia, Chediak-Higashi syndrome, albinism, Fanconi's aplastic anemia, and Bloom's syndrome; see Robbins and Angell, 1976, Basic Pathology, 2d Ed., W. B. Saunders Co., Philadelphia, pp. 112-113) etc.)
In another specific embodiment, an Antagonist Therapeutic of the invention is administered to a human patient to prevent progression to breast, colon, or cervical cancer.
5.9.2. Other Disorders
In other embodiments, a Therapeutic of the invention can be administered to prevent a nervous system disorder described in Section 5.8.2, or other disorder (e.g., liver cirrhosis, psoriasis, keloids, baldness) described in Section 5.8.3.
5.10. Demonstration of Therapeutic or Prophylactic Utility
The Therapeutics of the invention can be tested in vivo for the desired therapeutic or prophylactic activity. For example, such compounds can be tested in suitable animal model systems prior to testing in humans, including but not limited to rats, mice, chicken, cows, monkeys, rabbits, etc. For in vivo testing, prior to administration to humans, any animal model system known in the art may be used.
5.11. Antisense Regulation of Serrate Expression
The present invention provides the therapeutic or prophylactic use of nucleic acids of at least six nucleotides that are antisense to a gene or cDNA encoding Serrate or a portion thereof. "Antisense" as used herein refers to a nucleic acid capable of hybridizing to a portion of a Serrate RNA (preferably mRNA) by virtue of some sequence complementarity. Such antisense nucleic acids have utility as Antagonist Therapeutics of the invention, and can be used in the treatment or prevention of disorders as described supra in Section 5.8 and its subsections.
The antisense nucleic acids of the invention can be oligonucleotides that are double-stranded or single-stranded, RNA or DNA or a modification or derivative thereof, which can be directly administered to a cell, or which can be produced intracellularly by transcription of exogenous, introduced sequences.
In a specific embodiment, the Serrate antisense nucleic acids provided by the instant invention can be used for the treatment of tumors or other disorders, the cells of which tumor type or disorder can be demonstrated (in vitro or in vivo) to express a Serrate gene or a Notch gene. Such demonstration can be by detection of RNA or of protein.
The invention further provides pharmaceutical compositions comprising an effective amount of the Serrate antisense nucleic acids of the invention in a pharmaceutically acceptable carrier, as described infra in Section 5.12. Methods for treatment and prevention of disorders (such as those described in Sections 5.8 and 5.9) comprising administering the pharmaceutical compositions of the invention are also provided.
In another embodiment, the invention is directed to methods for inhibiting the expression of a Serrate nucleic acid sequence in a prokaryotic or eukaryotic cell comprising providing the cell with an effective amount of a composition comprising an antisense Serrate nucleic acid of the invention.
Serrate antisense nucleic acids and their uses are described in detail below.
5.11.1. Serrate Antisense Nucleic Acids
The Serrate antisense nucleic acids are of at least six nucleotides and are preferably oligonucleotides (ranging from 6 to about 50 oligonucleotides). In specific aspects, the oligonucleotide is at least 10 nucleotides, at least 15 nucleotides, at least 100 nucleotides, or at least 200 nucleotides. The oligonucleotides can be DNA or RNA or chimeric mixtures or derivatives or modified versions thereof, single-stranded or double-stranded. The oligonucleotide can be modified at the base moiety, sugar moiety, or phosphate backbone. The oligonucleotide may include other appending groups such as peptides, or agents facilitating transport across the cell membrane (see, e.g., Letsinger et al., 1989, Proc. Natl. Acad. Sci. U.S.A. 86:6553-6556; Lemaitre et al., 1987, Proc. Natl. Acad. Sci. 84:648-652; PCT Publication No. WO 88/09810, published Dec. 15, 1988) or blood-brain barrier (see, e.g., PCT Publication No. WO 89/10134, published Apr. 25, 1988), hybridization-triggered cleavage agents (see, e.g., Krol et al., 1988, BioTechniques 6:958-976) or intercalating agents (see, e.g., Zon, 1988, Pharm. Res. 5:539-549).
In a preferred aspect of the invention, a Serrate antisense oligonucleotide is provided, preferably of single-stranded DNA. In a most preferred aspect, such an oligonucleotide comprises a sequence antisense to the sequence encoding an SH3 binding domain or a Notch-binding domain of Serrate, most preferably, of human Serrate. The oligonucleotide may be modified at any position on its structure with substituents generally known in the art.
The Serrate antisense oligonucleotide may comprise at least one modified base moiety which is selected from the group including but not limited to 5-fluorouracil, 5-bromouracil, 5-chlorouracil, 5-iodouracil, hypoxanthine, xantine, 4-acetylcytosine, 5-(carboxyhydroxylmethyl) uracil, 5-carboxymethylaminomethyl-2-thiouridine, 5-carboxymethylaminomethyluracil, dihydrouracil, beta-D-galactosylqueosine, inosine, N6-isopentenyladenine, 1-methylguanine, 1-methylinosine, 2,2-dimethylguanine, 2-methyladenine, 2-methylguanine, 3-methylcytosine, 5-methylcytosine, N6-adenine, 7-methylguanine, 5-methylaminomethyluracil, 5-methoxyaminomethyl-2-thiouracil, beta-D-mannosylqueosine, 5'-methoxycarboxymethyluracil, 5-methoxyuracil, 2-methylthio-N6-isopentenyladenine, uracil-5-oxyacetic acid (v), wybutoxosine, pseudouracil, queosine, 2-thiocytosine, 5-methyl-2-thiouracil, 2-thiouracil, 4-thiouracil, 5-methyluracil, uracil-5-oxyacetic acid methylester, uracil-5-oxyacetic acid (v), 5-methyl-2-thiouracil, 3-(3-amino-3-N-2-carboxypropyl) uracil, (acp3)w, and 2,6-diaminopurine.
In another embodiment, the oligonucleotide comprises at least one modified sugar moiety selected from the group including but not limited to arabinose, 2-fluoroarabinose, xylulose, and hexose.
In yet another embodiment, the oligonucleotide comprises at least one modified phosphate backbone selected from the group consisting of a phosphorothioate, a phosphorodithioate, a phosphoramidothioate, a phosphoramidate, a phosphordiamidate, a methylphosphonate, an alkyl phosphotriester, and a formacetal or analog thereof.
In yet another embodiment, the oligonucleotide is an .alpha.-anomeric oligonucleotide. An .alpha.-anomeric oligonucleotide forms specific double-stranded hybrids with complementary RNA in which, contrary to the usual .beta.-units, the strands run parallel to each other (Gautier et al., 1987, Nucl. Acids Res. 15:6625-6641).
The oligonucleotide may be conjugated to another molecule, e.g., a peptide, hybridization triggered cross-linking agent, transport agent, hybridization-triggered cleavage agent, etc.
Oligonucleotides of the invention may be synthesized by standard methods known in the art, e.g. by use of an automated DNA synthesizer (such as are commercially available from Biosearch, Applied Biosystems, etc.). As examples, phosphorothioate oligonucleotides may be synthesized by the method of Stein et al. (1988, Nucl. Acids Res. 16:3209), methylphosphonate oligonucleotides can be prepared by use of controlled pore glass polymer supports (Sarin et al., 1988, Proc. Natl. Acad. Sci. U.S.A. 85:7448-7451), etc.
In a specific embodiment, the Serrate antisense oligonucleotide comprises catalytic RNA, or a ribozyme (see, e.g., PCT International Publication WO 90/11364, published Oct. 4, 1990; Sarver et al., 1990, Science 247:1222-1225). In another embodiment, the oligonucleotide is a 2'-0-methylribonucleotide (Inoue et al., 1987, Nucl. Acids Res. 15:6131-6148), or a chimeric RNA-DNA analogue (Inoue et al., 1987, FEBS Lett. 215:327-330).
In an alternative embodiment, the Serrate antisense nucleic acid of the invention is produced intracellularly by transcription from an exogenous sequence. For example, a vector can be introduced in vivo such that it is taken up by a cell, within which cell the vector or a portion thereof is transcribed, producing an antisense nucleic acid (RNA) of the invention. Such a vector would contain a sequence encoding the Serrate antisense nucleic acid. Such a vector can remain episomal or become chromosomally integrated, as long as it can be transcribed to produce the desired antisense RNA. Such vectors can be constructed by recombinant DNA technology methods standard in the art. Vectors can be plasmid, viral, or others known in the art, used for replication and expression in mammalian cells. Expression of the sequence encoding the Serrate antisense RNA can be by any promoter known in the art to act in mammalian, preferably human, cells. Such promoters can be inducible or constitutive. Such promoters include but are not limited to: the SV40 early promoter region (Bernoist and Chambon, 1981, Nature 290:304-310), the promoter contained in the 3' long terminal repeat of Rous sarcoma virus (Yamamoto et al., 1980, Cell 22:787-797), the herpes thymidine kinase promoter (Wagner et al., 1981, Proc. Natl. Acad. Sci. U.S.A. 78:1441-1445), the regulatory sequences of the metallothionein gene (Brinster et al., 1982, Nature 296:39-42), etc.
The antisense nucleic acids of the invention comprise a sequence complementary to at least a portion of an RNA transcript of a Serrate gene, preferably a human Serrate gene. However, absolute complementarity, although preferred, is not required. A sequence "complementary to at least a portion of an RNA," as referred to herein, means a sequence having sufficient complementarity to be able to hybridize with the RNA, forming a stable duplex; in the case of double-stranded Serrate antisense nucleic acids, a single strand of the duplex DNA may thus be tested, or triplex formation may be assayed. The ability to hybridize will depend on both the degree of complementarity and the length of the antisense nucleic acid. Generally, the longer the hybridizing nucleic acid, the more base mismatches with a Serrate RNA it may contain and still form a stable duplex (or triplex, as the case may be). One skilled in the art can ascertain a tolerable degree of mismatch by use of standard procedures to determine the melting point of the hybridized complex.
5.11.2. Therapeutic Utility of Serrate Antisense Nucleic Acids
The Serrate antisense nucleic acids can be used to treat (or prevent) malignancies or other disorders, of a cell type which has been shown to express Serrate or Notch. In specific embodiments, the malignancy is cervical, breast, or colon cancer, or squamous adenocarcinoma. Malignant, neoplastic, and pre-neoplastic cells which can be tested for such expression include but are not limited to those described supra in Sections 5.8.1 and 5.9.1. In a preferred embodiment, a single-stranded DNA antisense Serrate oligonucleotide is used.
Malignant (particularly, tumor) cell types which express Serrate or Notch RNA can be identified by various methods known in the art. Such methods include but are not limited to hybridization with a Serrate or Notch-specific nucleic acid (e.g. by Northern hybridization, dot blot hybridization, in situ hybridization), observing the ability of RNA from the cell type to be translated in vitro into Notch or Serrate, immunoassay, etc. In a preferred aspect, primary tumor tissue from a patient can be assayed for Notch or Serrate expression prior to treatment, e.g., by immunocytochemistry or in situ hybridization.
Pharmaceutical compositions of the invention (see Section 5.12), comprising an effective amount of a Serrate antisense nucleic acid in a pharmaceutically acceptable carrier, can be administered to a patient having a malignancy which is of a type that expresses Notch or Serrate RNA or protein.
The amount of Serrate antisense nucleic acid which will be effective in the treatment of a particular disorder or condition will depend on the nature of the disorder or condition, and can be determined by standard clinical techniques. Where possible, it is desirable to determine the antisense cytotoxicity of the tumor type to be treated in vitro, and then in useful animal model systems prior to testing and use in humans.
In a specific embodiment, pharmaceutical compositions comprising Serrate antisense nucleic acids are administered via liposomes, microparticles, or microcapsules. In various embodiments of the invention, it may be useful to use such compositions to achieve sustained release of the Serrate antisense nucleic acids. In a specific embodiment, it may be desirable to utilize liposomes targeted via antibodies to specific identifiable tumor antigens (Leonetti et al., 1990, Proc. Natl. Acad. Sci. U.S.A. 87:2448-2451; Renneisen et al., 1990, J. Biol. Chem. 265:16337-16342).
5.12. Therapeutic/Prophylactic Administration and Compositions
The invention provides methods of treatment (and prophylaxis) by administration to a subject of an effective amount of a Therapeutic of the invention. In a preferred aspect, the Therapeutic is substantially purified. The subject is preferably an animal, including but not limited to animals such as cows, pigs, chickens, etc., and is preferably a mammal, and most preferably human.
Various delivery systems are known and can be used to administer a Therapeutic of the invention, e.g., encapsulation in liposomes, microparticles, microcapsules, expression by recombinant cells, receptor-mediated endocytosis (see, e.g., Wu and Wu, 1987, J. Biol. Chem. 262:4429-4432), construction of a Therapeutic nucleic acid as part of a retroviral or other vector, etc. Methods of introduction include but are not limited to intradermal, intramuscular, intraperitoneal, intravenous, subcutaneous, intranasal, epidural, and oral routes. The compounds may be administered by any convenient route, for example by infusion or bolus injection, by absorption through epithelial or mucocutaneous linings (e.g., oral mucosa, rectal and intestinal mucosa, etc.) and may be administered together with other biologically active agents. Administration can be systemic or local. In addition, it may be desirable to introduce the pharmaceutical compositions of the invention into the central nervous system by any suitable route, including intraventricular and intrathecal injection; intraventricular injection may be facilitated by an intraventricular catheter, for example, attached to a reservoir, such as an Ommaya reservoir. Pulmonary administration can also be employed, e.g., by use of an inhaler or nebulizer, and formulation with an aerosolizing agent.
In a specific embodiment, it may be desirable to administer the pharmaceutical compositions of the invention locally to the area in need of treatment; this may be achieved by, for example, and not by way of limitation, local infusion during surgery, topical application, e.g., in conjunction with a wound dressing after surgery, by injection, by means of a catheter, by means of a suppository, or by means of an implant, said implant being of a porous, non-porous, or gelatinous material, including membranes, such as sialastic membranes, or fibers. In one embodiment, administration can be by direct injection at the site (or former site) of a malignant tumor or neoplastic or pre-neoplastic tissue.
In another embodiment, the Therapeutic can be delivered in a vesicle, in particular a liposome (see Langer, Science 249:1527-1533 (1990); Treat et al., in Liposomes in the Therapy of Infectious Disease and Cancer, Lopez-Berestein and Fidler (eds.), Liss, New York, pp. 353-365 (1989); Lopez-Berestein, ibid., pp. 317-327; see generally ibid.) In yet another embodiment, the Therapeutic can be delivered in a controlled release system. In one embodiment, a pump may be used (see Langer, supra; Sefton, CRC Crit. Ref. Biomed. Eng. 14:201 (1987); Buchwald et al., Surgery 88:507 (1980); Saudek et al., N. Engl. J. Med. 321:574 (1989)). In another embodiment, polymeric materials can be used (see Medical Applications of Controlled Release, Langer and Wise (eds.), CRC Pres., Boca Raton, Florida (1974); Controlled Drug Bioavailability, Drug Product Design and Performance, Smolen and Ball (eds.), Wiley, New York (1984); Ranger and Peppas, J. Macromol. Sci. Rev. Macromol. Chem. 23:61 (1983); see also Levy et al., Science 228:190 (1985); During et al., Ann. Neurol. 25:351 (1989); Howard et al., J. Neurosurg. 71:105 (1989)). In yet another embodiment, a controlled release system can be placed in proximity of the therapeutic target, i.e., the brain, thus requiring only a fraction of the systemic dose (see, e.g., Goodson, in Medical Applications of Controlled Release, supra, vol. 2, pp. 115-138 (1984)).
Other controlled release systems are discussed in the review by Langer (Science 249:1527-1533 (1990)). In a specific embodiment where the Therapeutic is a nucleic acid encoding a protein Therapeutic, the nucleic acid can be administered in vivo to promote expression of its encoded protein, by constructing it as part of an appropriate nucleic acid expression vector and administering it so that it becomes intracellular, e.g., by use of a retroviral vector (see U.S. Pat. No. 4,980,286), or by direct injection, or by use of microparticle bombardment (e.g., a gene gun; Biolistic, Dupont), or coating with lipids or cell-surface receptors or transfecting agents, or by administering it in linkage to a homeobox-like peptide which is known to enter the nucleus (see e.g., Joliot et al., 1991, Proc. Natl. Acad. Sci. USA 88:1864-1868), etc. Alternatively, a nucleic acid Therapeutic can be introduced intracellularly and incorporated within host cell DNA for expression, by homologous recombination.
In specific embodiments directed to treatment or prevention of particular disorders, preferably the following forms of administration are used:
The present invention also provides pharmaceutical compositions. Such compositions comprise a therapeutically effective amount of a Therapeutic, and a pharmaceutically acceptable carrier. In a specific embodiment, the term "pharmaceutically acceptable" means approved by a regulatory agency of the Federal or a state government or listed in the U.S. Pharmacopeia or other generally recognized pharmacopeia for use in animals, and more particularly in humans. The term "carrier" refers to a diluent, adjuvant, excipient, or vehicle with which the therapeutic is administered. Such pharmaceutical carriers can be sterile liquids, such as water and oils, including those of petroleum, animal, vegetable or synthetic origin, such as peanut oil, soybean oil, mineral oil, sesame oil and the like. Water is a preferred carrier when the pharmaceutical composition is administered intravenously. Saline solutions and aqueous dextrose and glycerol solutions can also be employed as liquid carriers, articularly for injectable solutions. Suitable harmaceutical excipients include starch, glucose, lactose, sucrose, gelatin, malt, rice, flour, chalk, silica gel, sodium stearate, glycerol monostearate, talc, sodium chloride, dried skim milk, glycerol, propylene, glycol, water, ethanol and the like. The composition, if desired, can also contain minor amounts of wetting or emulsifying agents, or pH buffering agents. These compositions can take the form of solutions, suspensions, emulsion, tablets, pills, capsules, powders, sustained-release formulations and the like. The composition can be formulated as a suppository, with traditional binders and carriers such as triglycerides. Oral formulation can include standard carriers such as pharmaceutical grades of mannitol, lactose, starch, magnesium stearate, sodium saccharine, cellulose, magnesium carbonate, etc. Examples of suitable pharmaceutical carriers are described in "Remington's Pharmaceutical Sciences" by E. W. Martin. Such compositions will contain a therapeutically effective amount of the Therapeutic, preferably in purified form, together with a suitable amount of carrier so as to provide the form for proper administration to the patient. The formulation should suit the mode of administration.
In a preferred embodiment, the composition is formulated in accordance with routine procedures as a pharmaceutical composition adapted for intravenous administration to human beings. Typically, compositions for intravenous administration are solutions in sterile isotonic aqueous buffer. Where necessary, the composition may also include a solubilizing agent and a local anesthetic such as lignocaine to ease pain at the site of the injection. Generally, the ingredients are supplied either separately or mixed together in unit dosage form, for example, as a dry lyophilized powder or water free concentrate in a hermetically sealed container such as an ampoule or sachette indicating the quantity of active agent. Where the composition is to be administered by infusion, it can be dispensed with an infusion bottle containing sterile pharmaceutical grade water or saline. Where the composition is administered by injection, an ampoule of sterile water for injection or saline can be provided so that the ingredients ay be mixed prior to administration.
The Therapeutics of the invention can be formulated as neutral or salt forms. Pharmaceutically acceptable salts include those formed with free amino groups such as those derived from hydrochloric, phosphoric, acetic, oxalic, tartaric acids, etc., and those formed with free carboxyl groups such as those derived from sodium, potassium, ammonium, calcium, ferric hydroxides, isopropylamine, triethylamine, 2-ethylamino ethanol, histidine, procaine, etc.
The amount of the Therapeutic of the invention which will be effective in the treatment of a particular disorder or condition will depend on the nature of the disorder or condition, and can be determined by standard clinical techniques. In addition, in vitro assays may optionally be employed to help identify optimal dosage ranges. The precise dose to be employed in the formulation will also depend on the route of administration, and the seriousness of the disease or disorder, and should be decided according to the judgment of the practitioner and each patient's circumstances. However, suitable dosage ranges for intravenous administration are generally about 20-500 micrograms of active compound per kilogram body weight. Suitable dosage ranges for intranasal administration are generally about 0.01 pg/kg body weight to 1 mg/kg body weight. Effective doses may be extrapolated from dose-response curves derived from in vitro or animal model test systems.
Suppositories generally contain active ingredient in the range of 0.5% to 10% by weight; oral formulations preferably contain 10% to 95% active ingredient.
The invention also provides a pharmaceutical pack or kit comprising one or more containers filled with one or more of the ingredients of the pharmaceutical compositions of the invention. Optionally associated with such container(s) can be a notice in the form prescribed by a governmental agency regulating the manufacture, use or sale of pharmaceuticals or biological products, which notice reflects approval by the agency of manufacture, use or sale for human administration.
5.13. Diagnostic Utility
Serrate proteins, analogues, derivatives, and subsequences thereof, Serrate nucleic acids (and sequences complementary thereto), anti-Serrate antibodies, have uses in diagnostics. Such molecules can be used in assays, such as immunoassays, to detect, prognose, diagnose, or monitor various conditions, diseases, and disorders affecting Serrate expression, or monitor the treatment thereof. In particular, such an immunoassay is carried out by a method comprising contacting a sample derived from a patient with an anti-Serrate antibody under conditions such that immunospecific binding can occur, and detecting or measuring the amount of any immunospecific binding by the antibody. In a specific aspect, such binding of antibody, in tissue sections, preferably in conjunction with binding of anti-Notch antibody can be used to detect aberrant Notch and/or Serrate localization or aberrant levels of Notch-Serrate colocalization in a disease state. In a specific embodiment, antibody to Serrate can be used to assay in a patient tissue or serum sample for the presence of Serrate where an aberrant level of Serrate is an indication of a diseased condition. Aberrant levels of Serrate binding ability in an endogenous Notch protein, or aberrant levels of binding ability to Notch (or other Serrate ligand) in an endogenous Serrate protein may be indicative of a disorder of cell fate (e.g., cancer, etc.) By "aberrant levels," is meant increased or decreased levels relative to that present, or a standard level representing that present, in an analogous sample from a portion of the body or from a subject not having the disorder.
The immunoassays which can be used include but are not limited to competitive and non-competitive assay systems sing techniques such as western blots, radioimmunoassays, ELISA (enzyme linked immunosorbent assay), "sandwich" immunoassays, immunoprecipitation assays, precipitin reactions, gel diffusion precipitin reactions, immunodiffusion assays, agglutination assays, complement-fixation assays, immunoradiometric assays, fluorescent immunoassays, protein A immunoassays, to name but a few.
Serrate genes and related nucleic acid sequences and subsequences, including complementary sequences, and other toporythmic gene sequences, can also be used in hybridization assays. Serrate nucleic acid sequences, or subsequences thereof comprising about at least 8 nucleotides, can be used as hybridization probes. Hybridization assays can be used to detect, prognose, diagnose, or monitor conditions, disorders, or disease states associated with aberrant changes in Serrate expression and/or activity as described supra. In particular, such a hybridization assay is carried out by a method comprising contacting a sample containing nucleic acid with a nucleic acid probe capable of hybridizing to Serrate DNA or RNA, under conditions such that hybridization can occur, and detecting or measuring any resulting hybridization.
Additionally, since Serrate binds to Notch, Serrate or a binding portion thereof can be used to assay for the presence and/or amounts of Notch in a sample, e.g., in screening for malignancies which exhibit increased Notch expression such as colon and cervical cancers.
6. The Gene Serrate Encodes a Putative Egf-Like Transmembrane Protein Essential for Proper Ectodermal Development in Drosophila Melanogaster
As described in the example herein (see Fleming et al., 1990, Genes Dev. 4:2188-2201), mutations in the third chromosome gene Serrate are shown to display genetic interactions with specific alleles of the neurogenic locus Notch, which encodes a transmembrane protein with epidermal growth factor homology. The locus Serrate displays a striking phenotypic interaction with a specific Notch allele known to affect postembryonic development. We present the molecular cloning of Serrate and show that it encodes two coordinately-expressed transcripts from a genomic interval greater than 30 kilobases in length. The deduced protein product of 1404 amino acids contains a single transmembrane domain and 14 epidermal growth factor-like repeats. Whole-mount in situ hybridization analysis revealed complex temporal and spatial patterns of RNA expression consistent with the epidermal and neuronal defects observed in mutant embryos.
We demonstrate that the Serrate locus encodes an essential function, the loss of which results in embryonic lethality brought about by the disruption of both neuronal and epidermal tissues. Serrate is likely to represent an element in a network of interacting molecules operating at the cell surface during the differentiation of certain tissues.
6.1. Results
6.1.1. The Serrate and Notch Genes Interact Phenotypically
In the course of genetic crosses designed to detect interactions between the Notch locus and other genes in Drosophila, a dramatic phenotypic interaction was observed between the Notch allele notchoid (nd) and the third chromosome mutation Serrate (designated Ser.sup.D herein). The recessive nd mutation, which is associated with an amino acid substitution in the intracellular portion of the Notch protein (Xu et al., 1990, Genes Dev. 4:464-475), causes wing notches in the adult (see FIG. 1b; compare to wildtype, FIG. 1a). The Ser.sup.D mutation is dominant and in heterozygous condition produces an adult wing blade very similar to that of nd animals (compare FIGS. 1b and 1c). The phenotypic interaction seen in nd/Y; Ser.sup.D /+ males is characterized by loss of anterior and posterior wing margins, as well as loss of distal wing blade tissue. Concomitant with this loss, thickening of the L3 and L5 wing veins is observed (see FIG. 1d).
Even though both the Ser.sup.D and nd mutations affect wing blade development, the interaction appears to be synergistic because a novel phenotype is seen, that is, rather than just additive effects. To explore this question of synergy further, we constructed flies carrying genetic duplications of Notch.sup.+. Animals carrying an extra copy of Notch.sup.+ normally exhibit a Confluens phenotype characterized by wing vein thickening. Surprisingly, animals bearing Ser.sup.D and an extra copy of Notch.sup.+ have essentially wild-type wings (FIG. 1e), that is, both the Ser.sup.D wing nicking and the Confluens phenotypes are suppressed in this combination. This interaction was noted using both Dp(1;2)51b (a large genetic duplication of 3C1-2; 3D6 including N.sup.+) and CosP479BE (N.sup.+) (86E5-6), a cosmid construct containing only the N.sup.+ gene (Ramos et al., 1989, Genetics 123:337:348)!.
Because the Ser.sup.D mutation is neomorphic, the interactions observed between Ser.sup.D and Notch mutations might not be representative of interactions normally occurring between these gene products. We therefore examined the phenotypes of nd males heterozygous for Df(3R)Ser.sup.+82f24 (nd/Y; Df(3R)Ser.sup.+82f24 /+). These animals exhibit a significantly increased mutant wing phenotype as compared to nd alone (not shown). Thus, it appears that Notch and Ser.sup.D mutually influence each other's phenotypic expression.
6.1.2. Genetic Characterization of Serrate
Previous genetic characterizations have demonstrated that the Ser.sup.D mutation maps to the 97F region of the polytene chromosomes and is neomorphic, producing the dominant wing nicking phenotype shown in FIG. 1d (Belt, 1971, Drosophila Inf. Serv. 46:116; P. Lewis, Yale University; unpubl.). The neomorphic nature is demonstrated genetically via the insensitivity of the Ser.sup.D phenotype to the number of wildtype (Ser.sup.+) copies present, that is Ser.sup.D /+/+ displays a phenotype similar to Ser.sup.D /+ and to Ser.sup.D /Deficiency (P. Lewis, pers. comm.). Flies with only one copy of wild-type Ser.sup.+ (i.e., individuals heterozygous for a wild-type allele over deficiencies) are phenotypically wild-type, demonstrating that reduction of gene product (i.e., haploinsufficiency) is not causing the dominant phenotype. Finally, when the Ser.sup.D mutation is homozygous, viable adults are produced that display a more severe wing phenotype than heterozygous Ser.sup.D /+ animals (FIG. 1f). Thus, the expression of the Ser.sup.D wing phenotype appears to be directly related to the expression of a mutant or novel gene product rather than to Ser.sup.+ gene dosage.
In an effort to obtain amorphic alleles of Serrate, we used X-ray mutagenesis to produce phenotypic revertants of the dominant mutation (see Section 6.3 for details). All five of the revertants of the Ser.sup.D mutation are lethal when homozygous and, consistent with the deficiency phenotypes, are phenotypically wild-type when heterozygous with a wild-type chromosome. Complementation tests revealed that the Ser.sup.revertants are allelic. Moreover, transheterozygotes of nd with two different Ser.sup.revertants alleles (nd/Y; Ser.sup.rev2-3 /+ and nd/Y; Ser.sup.rev2-11 /+) exhibit an enhanced mutant wing phenotype as compared to nd mutants, in agreement with the Ser.sup.D -Notch interactions noted previously.
These complementation tests were extended to include another dominant mutation, Beaded of Goldschmidt (Bd.sup.G), which also maps to the 97F region. Heterozygous adults bearing the Bd.sup.G mutation display a wing nicking phenotype that is more severe than that observed in Ser.sup.D heterozygotes (data not shown). Moreover, the Bd.sup.G mutation, unlike Ser.sup.D, is homozygous lethal. Finally, three alleles (Bd.sup.43.5, Bd.sup.862.5, and pll.sup.11) of a lethal complementation group isolated in K. Anderson's laboratory were shown to be allelic to Bd.sup.G (P. Hecht, unpubl.; a complete listing of the alleles used and their descriptions is provided in Section 6.3). Although transheterozygotes of Ser.sup.D and Bd.sup.G are viable, it is interesting to note that Df(3R)Ser.sup.+82f4 and most of the Ser.sup.revertants fail to complement the Bd.sup.G mutation for viability. The exception is the Ser.sup.rev2-3 allele, which although homozygous lethal, complements Bd.sup.G. Despite the exceptional Ser.sup.rev2-3 allele, these results suggest that the Serrate and Beaded mutations are alleles of the same gene (see also below). Consistent with this idea is the fact that Ser.sup.revertant and Bd alleles have similar phenotypes (see also below).
6.1.3. Characterization of Serrate Mutant Phenotypes
Several revertants of Ser.sup.D, a dominant allele of Serrate, have been isolated (Thomas et al., 1991, Dev. 111:749-761; Fleming et al., 1990, Genes Dev. 4:2188-2201; Speicher et al., 1994, Develop. 120:535-544). In general, such revertants are lethal, displaying larval lethality. However, the exact timing of lethality has been difficult to determine. A combination of expression data, overexpression studies and genetic analyses, including genetic mosaics, indicate that Serrate function is necessary for imaginal development (Speicher et al., 1994, Develop. 120:535-544). Early phenotypic data suggesting that Serrate affects embryonic development (Fleming et al., 1990, Genes Dev. 4:2188-2201), were shown to be due to interactions between Serrate and the genes in the balancer chromosome TM2 (Gu et al., 1995, Develop. 121, in press).
6.1.4. Molecular Characterization of Serrate DNA
In an effort to elucidate the molecular nature of the Serrate gene product, DNA from the 97F region was cloned and characterized. A Drosophila genomic clone, previously isolated on the basis of cross hybridization to the EGF-like domain of the Notch gene (Rothberg et al., 1988, Cell 55:1047-1059), was used as an entry point to initiate a chromosomal walk. From this initial clone, eight recombinant phage spanning .about.85 kb of genomic DNA were isolated (see FIG. 2). A BamHI site adjacent to the region of EGF homology was arbitrarily chosen as coordinate position zero.
Genomic Southern blots containing mutant and wild-type DNAs were probed with DNA from the individual phage isolates to detect and localize rearrangement breakpoints that might be associated with the various Serrate alleles. Within the first phage isolate, .o slashed.10.2, restriction fragment polymorphisms were detected on the original Ser.sup.D chromosome. The polymorphism detected with each of three restriction enzymes (EcoRI, BamHI, and HindIII) was consistent with an insertion of .about.5.5 kb of DNA between map coordinates 0 and -3 (FIG. 2). Subsequent Southern analysis using DNA cloned from Ser.sup.D revealed a repeated DNA sequence, suggesting the presence of a mobile insertional element associated with the mutation. In addition to the insertion, the HindIII site at coordinate -2 has been eliminated in the Ser.sup.D chromosome. Because the parental chromosome from which the Ser.sup.D mutation arose is unavailable, we cannot be certain that the noted polymorphisms are causal to the Ser.sup.D phenotype.
Of the five Ser.sup.revertant alleles, three (Ser.sup.rev2-3, Ser.sup.rev5-5, and Ser.sup.rev6-1) appeared cytologically normal and did not exhibit DNA polymorphisms detectable by our Southern analyses. The remaining two revertants, Ser.sup.rev2-11 and Ser.sup.rev 3, had polymorphic DNA restriction fragments within the cloned region. Ser.sup.rev2-11 is an inversion of polytene bands 97F to 98C. The 97F breakpoint was localized between coordinates +1.5 to +4, within the region of strongest detectable EGF homology (FIG. 2). Ser.sup.rev 3 is a reciprocal translocation of chromosomes 3R and 2R, with the 97F breakpoint localized between coordinates +15 and +17 (FIG. 2). In situ hybridization of the cloned wild-type genomic DNAs to polytene chromosomes of Ser.sup.rev 3 and Ser.sup.rev2-11 confirmed that the observed DNA polymorphisms represent the 97F breakpoints of these chromosomal rearrangements.
As noted earlier, Ser.sup.revertant alleles fail to complement Bd.sup.G, suggesting that the Serrate and Bd mutations are alleles of the same gene. As with the Ser.sup.D mutation, the parental chromosome for the Bd.sup.G mutation was not available; hence, unambiguous assignment of mutant phenotypes to DNA polymorphisms cannot be made. Cytological observations of the Bd.sup.G chromosome failed to reveal any visible abnormalities; however, two regions of DNA polymorphism were detectable by Southern analysis. These regions lie between coordinates 0 to +1 and +14 to +17. Investigations of the polymorphism at position 0 to +1 were pursued by cloning the mutant DNA sequences. Preliminary results indicate that the polymorphisms do not result from a small inversion between these two regions but, rather, from a more complex event.
Of the three mutant chromosomes, Bd.sup.43.5, Bd.sup.862.5, and pll.sup.11, only pll.sup.11 found to have a DNA polymorphism, which was localized between coordinates +17 and +19 (FIG. 2). Genetic and cytological data for the pll.sup.11 suggest the presence of a very small chromosomal aberration within the 97F region (P. Hecht, pers. comm.), and the molecular data are consistent with this observation. Finally, T(Y:3)R128 is a reciprocal translocation that also breaks within the 97F region (Lindsley et al., 1972, Genetics 71:157-184) and fails to complement Bd.sup.G (P. Hecht, pers. comm.). The DNA breakpoint for this translocation resides at map coordinates +25 to +28 (FIG. 2). Taken together, these findings strengthen the genetic evidence that Serrate and Bd mutations are alleles of the same gene. In summary, of eleven tested chromosomes containing Serrate or Bd mutation, six were shown to have associated DNA rearrangements within a kb region known to contain EGF homologous sequences.
To examine the structure of the Serrate transcription unit, we probed Northern blots containing 2- to 14-hour embryonic poly(A).sup. RNA with the recombinant phages spanning this region (.o slashed.10.1, .o slashed.1.3 and .o slashed.15K; FIG. 2). This analysis revealed the presence of two transcripts of .about.5.5 kb and 5.6 kb. We isolated two overlapping cDNA clones, denoted C1 and C3, from an early pupal library (see Section 6.3). Sequence analysis of these cDNAs revealed a perfect overlap of 109 bp for a combined length of 5.6 kb, which is in excellent agreement with the larger of the two transcripts as determined by northern analysis. Genomic probes unique to the 5' end of C3 only detected the larger 5.6 kb transcript. Thus, the size difference between the 5.5 and 5.6 kb transcripts may represent an alteration in the potential protein coding capacity or an alteration of 5' untranslated sequence. The composite 5.6 kb cDNA confirms that the Serrate transcription unit spans .about.30 kb of genomic DNA, encompasses the EGF homologous region, and is interrupted by at least five of the six DNA rearrangements that affect Serrate function (FIG. 2). From Southern analysis, at least two introns are apparent; additional introns are likely but not detectable at this level of resolution.
6.1.5. Serrate Encodes a Putative Transmembrane Protein With 14 Egf-Like Repeats
The complete nucleotide sequence compiled from the cDNAs C1 and C3 is 5561 bp (see FIGS. 3A-3F) and agrees with the transcript sizes determined by northern analysis. Within this sequence there is a single large open reading frame (ORF) of 4329 bp. There are two possible initiator AUG codons at positions 433 and 442. Of these, the second AUG is within a sequence context that agrees with the Drosophila consensus sequence determined for translation initiation CAAAAUG; (Cavener, 1987, Nucl. Acids Res. 15:1353-1361)!. Predicted codon usage within this ORF is highly consistent with established Drosophila melanogaster codon preferences (Beachy et al., 1985, Nature 313:545-550). Assuming that translation starts at the second AUG, the Serrate mRNA contains an untranslated leader sequence of at least 441 base pairs, encodes an expected protein product of 1404 amino acids, and terminates with 908 bp of untranslated 3' sequence (FIG. 4a). However, if translation begins at the first AUG, the protein product is 1443 amino acids.
Hydropathy plots revealed three major hydrophobic regions (FIG. 4b; see also Section 6.3). The first, beginning at amino acid 51, is likely to represent a signal peptide sequence; a potential signal cleavage site occurs at amino acid 80. A second hydrophobic domain runs from amino acid 540 to 560. This region does not have a requisite transmembrane structure and is more likely to be a membrane-associated domain. The third hydrophobic domain (amino acids 1220 to 1245) is bounded by hydrophilic residues and is therefore likely to represent a true transmembrane domain.
The most striking structural feature of the predicted protein is the series of EGF-like repeats (see FIG. 4c). There are 14 copies of this motif with an additional partial or degenerate repeat occurring toward the amino terminus (see below). In addition, at least three of these repeats are interrupted by stretches of amino acids. The first interruption (labelled A in FIG. 4c), which occurs in the fourth complete EGF-like repeat (repeats are numbered beginning from the amino terminus), is .about.64 amino acids in length and is enriched for serine residues. The second interruption (labelled B in FIG. 4c), occurring in the sixth repeat, is .about.44 amino acids long and has numerous hydrophobic residues. This region represents the putative membrane-associated domain noted earlier. The final interruption (labelled C in FIG. 4c), which occurs in the tenth repeat and is 29 amino acids in length, has an unusual run of threonines Thr.sub.(9) Ala Thr.sub.(3) !.
Within the amino-terminal region of the Serrate protein, considerable structural homology (darkly-shaded region in FIG. 4c) is observed with the main protein product of the Delta locus (Vassin et al., 1987, EMBO J. 6:3431-3440;Kopczynski et al., 1988, Genes Dev. 2:1723-1735). Near the signal peptides for both of these molecules there lies a stretch of .about.210 conserved amino acids. Within the first 165 amino acids, there is .about.32% identity, which increases to greater than 50% for the remaining 45 amino acids. The latter region corresponds to the partial EGF-like repeat (designated PR in FIG. 4c), which lacks a cysteine residue but retains the other characteristic cysteines and conserved amino acids typically found in the remaining EGF-like repeats. The homology between Serrate and Delta extends beyond these amino-terminal regions, since both of these proteins contain EGF-like repeats.
In addition to the extracellular EGF-like sequences, the predicted Serrate protein contains a small intracellular domain of .about.160 amino acids. The internal domain does not contain any significant known structural homologies, although there are numerous potential sites for phosphorylation (Those identified in the putative intracellular region by the SITES program were at amino acid positions 1283, 1292, 1297, 1349, 1365, 1371, 1389, and 1390).
20 6.1.6. Expression of Serrate RNA
Northern analysis of developmentally staged RNAs revealed that the majority of Serrate expression is represented by two coordinately regulated transcripts of 5.5 kb and 5.6 kb, which first appear 4 to 8 hours into embryogenesis (FIG. 5). These transcripts show peak expression between 8 and 12 hours of embryogenesis and diminish thereafter; however, they continue to be readily detectable throughout development except for the adult stages (FIG. 5). In addition to these major transcripts, a smaller (3.4 kb) transcript is expressed transiently between 2 and 4 hours of embryogenesis (FIG. 5).
We undertook an analysis of the spatial distribution of RNA transcripts from the Serrate locus in order to identify regions of the embryo that may require Serrate function. Using the whole mount in situ method (Tautz and Pfeifle, 1989, Chromosoma 98:81-85) and employing nonradioactive probes that hybridize to both the 5.5 kb and 5.6 kb transcripts, we found that Serrate mRNA accumulates in a dynamic pattern beginning from mid-embryogenesis (late stage 10) and persisting until the latest stages examined (stage 16); (embryonic stages are those of Campos-Ortega and Hartenstein, 1985, The Embryonic Development of Drosophila Melanogaster, Springer-Verlag, Berlin). Because the tissue distribution of the two transcripts may be independently regulated, we note that the observed RNA localizations may represent a composite for both transcripts. We also note the possibility of a low level of Serrate RNA in the yolk of pre-gastrulation embryos because faint staining of the yolk was observed consistently. Although this staining was never observed with control probes (see Section 6.3), the presence of yolk staining is known to be a common artifact of the whole-mount in situ technique (Ashburner, 1989, Drosophila--A laboratory manual, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y.). However, if this observation is not artifactual, the observed staining may correspond to the expression of the transient 3.4 kb RNA species observed by the northern analysis of this same developmental stage.
Initial cellular localization was seen in late-stage 10 embryos and consisted of a ring of cells in the foregut. The foregut is formed by the invagination of the stomodeum (the initial event of stage 10); thus, the foregut is actually derived from ectodermal tissue. Shortly thereafter, a bilateral patch of expressing cells appeared in the anterior-most portion of the head, the presumptive clypeolabrum (FIG. 6a). Additional areas of expression appeared abruptly at the end of stage 10 in a group of cells on the lateral edge of abdominal segment 8, followed by cells near the proctodeum and lateral epidermis of abdominal segment 9 (FIG. 6b). Later, during stage 11, expression was detected within cells located at the junction between the labial and maxillary lobes and within cells located near the tracheal pit of the first thoracic segment. The expression pattern progressed to include a group of lateral epidermal cells located between the tracheal pits in each of the thoracic and abdominal segments (FIG. 6c). In addition, each abdominal segment displayed a cluster of cells on either side of the ventral midline.
During germ band retraction (stage 12), the lateral epidermal cell patches broadened to form stripes that lie in the middle of each segment. A portion of these cells appeared to coalesce into an internal longitudinal stripe that was coincident with the developing tracheae (see FIGS. 6e, f, g, and h). The cells that remained on the surface extended dorsally and ventrally forming a zig-zag shaped pattern (FIG. 6g, arrows). This surface expression in the thoracic segments was wider, more intense, and extended further dorsally and ventrally than in the abdominal segments (FIG. 6g). Later in embryogenesis (stages 14 and 15) the surface epidermal expression, with the exception of the, first thoracic segment, diminished relative to the tracheal expression. Later, intense expression was observed in what appeared to be ectodermal invaginations located dorsolaterally on the thoracic segments (FIG. 6j). These pockets of cells may correspond to primordia of imaginal discs; in the first thoracic segment they appeared to be closely associated with opening of the anterior spiracle.
Coincident with the lateral expression, another segmentally reiterated pattern evolved in the ventral epidermis of the trunk. In the extended germ band embryo, this pattern, which consisted of stripes of expressing cells near the anterior border of the abdominal segments, lay out of register with the corresponding lateral expression (FIG. 6c). The pattern in the thorax contrasted with that in the abdomen and consisted of only small clusters of expressing cells in the latero-ventral region (see FIGS. 6f and 6h). The ventral expression was quite intense through stage 13 and dissipated thereafter (FIG. 6l).
Serrate expression was also observed in the ectodermally-derived portions of the gut. The earliest expression was evident in the foregut and persisted throughout embryonic development (FIG. 6a). During germband retraction, a tightly defined, intensely expressing ring of cells lay at the junction with the anterior midgut. The proventriculus develops from this area; however, expression was limited to the ectodermally-derived portion of this composite structure (King, 1988, J. Morph. 196:253-282). Hindgut expression, though appearing later than foregut expression, occurred at an analogous position, that is, where ectoderm meets endoderm. The initial expression in the hindgut was seen at the time of germ band retraction (stage 12) as a wide band of cells where the Malphigian tubules were forming, but never included the tubules themselves. Later still (stage 14), an additional ring of expression appeared in the hindgut approximately mid-way between the insertion point of the Malphigian tubules and the proctodeum (FIG. 6h). Expression at the posterior-most end of the embryo, near the proctodeal opening, initiated early (stage 11) (FIG. 6b). This expression within the telson remained at high levels throughout embryonic development, eventually forming a ring of cells around the presumptive anal pads (FIG. 6l). Within the head region, Serrate expression was temporally and spatially dynamic. The earliest expression occurred in the presumptive clypeolabrum (stage 10; FIG. 6a) and became broader and more intense as development proceeded. Early expression between the labial and maxillary lobes increased along their borders, and expression was also seen in the anterior of the mandibular lobe during stage 12 (FIGS. 6d and 6e). In addition, expression was now observed in the hypopharyngeal region, just posterior to the stomodeum, and at the base of the labial lobes in an area encompassing the salivary gland duct opening (FIG. 6d). There was also low level expression in the dorsal procephalic epidermal region (not shown). By the end of germ band retraction (stage 13), expression encompassed the entire mandibular lobe. As a consequence of the cellular movements associated with head involution (stages 14-16), the expressing cells of the clypeolabrum, hypopharynx and labial lobes combined to form the pharynx. Prior expression in the area of the salivary gland placodes was now limited to the ducts of the developing salivary gland (FIG. 6i). The maxillary and mandibular lobes, which have moved to the anterior-most region of the embryo, expressed intensely at this time (FIG. 6j).
Serrate expression in the central nervous system (CNS) was apparent during stage 12 as a segmentally-reiterated array of single cells along the lateral edge of the ventral nerve cord and within the supraesophogeal ganglia (brain hemispheres). By the end of germ band retraction (stage 13), there were now two cells that appeared to express in each hemisegment of the ventral nerve cord (not shown). However, by stage 15, ventral nerve cord expression was again limited to a single cell per hemisegment (FIG. 6i) while expression in the brain hemispheres remained unchanged (FIG. 6k).
In summary, there are a wide array of tissues that express Serrate mRNA, and the expression pattern is tightly regulated both temporally and spatially. In addition, it should be stressed that at the present level of resolution, Serrate expression appears to be restricted exclusively to cells of ectodermal origin.
6.2. Discussion
Unlike Notch and Delta, the fourteen EGF repeats of Serrate are not completely contiguous. At least three of these repeats contain sizeable interruptions consisting of insertions of long stretches of amino acids. Similarly, interruptions have been noted in two of the thirty EGF-like repeats of the Drosophila gene crumbs (Tepass et al., 1990, Cell 61:787-799). In Serrate, the interruption that occurs in the sixth repeat is particularly intriguing because it consists largely of hydrophobic amino acids. Although hydropathy plots indicate that this region does not conform to known transmembrane regions, it could represent a membrane-associated domain that serves to "tie" the protein back to the membrane. The interruption in the tenth repeat is also unusual in that it bears a stretch of threonines Thr.sub.(9) Ala Thr.sub.(3) !. A similar motif of thirteen contiguous threonine residues is found in the glycoprotein glutactin, a basement membrane protein of Drosophila (Olson et al., 1990, EMBO J. 9:1219-1227).
If the observed genetic interactions between Notch and Serrate had been only with the original Ser.sup.D allele, it could have been argued that this neomorphic mutation is allowing two functionally disparate but structurally similar molecules to interact out of their normal contexts. But because we observe genetic interactions with other Serrate alleles, it is likely that we are observing a manifestation of normal Serrate-Notch interactions.
We have shown that phenotypic revertants of Ser.sup.D behave genetically in a similar fashion to known deficiencies for the locus; that is, they are homozygous lethal during embryogenesis and completely recessive as heterozygotes. We also gathered evidence indicating that the mutation Bd.sup.G, which was thought to belong to a distinct complementation group, may in fact be an allele of Serrate.
The embryonic lethal phenotypes of Ser.sup.rev2-3, Ser.sup.rev2-11, and Ser.sup.rev5-5, which are essentially indistinguishable from one another, appear unchanged when in homozygous or hemizygous condition. This latter result genetically defines these alleles genetically as amorphic. However, since the Ser.sup.rev2-3 allele complements the Bd.sup.G mutation, the Ser.sup.rev2-3 mutation is probably not a protein null allele.
Consistent with the defects observed in the cuticle and nervous system of Ser.sup.- embryos, Serrate transcripts are localized in complex patterns within these tissues. The abundant and widespread expression of Serrate transcripts in the segments that make up the embryonic head and thorax correlates well with the lack of embryonic head and thoracic structures commonly seen in Ser.sup.- embryos. Likewise, the pattern of Serrate expression in the ventral epidermis of the abdominal segments correlates with the frequently absent or improperly formed denticles. Although Serrate is expressed in a small number of cells within the CNS, the gross morphological defects observed in the CNS of Ser.sup.- embryos may reflect contributions from two components. The first is the loss of Serrate CNS expression itself, and the second may be a consequence of mechanical stresses (e.g., lack of germ band retraction) imposed by an improperly differentiating epidermis.
In the course of examining the embryonic phenotypes associated with Serrate lethal mutations, we noticed their similarity to those produced by several alleles of the gene coding for the Drosophila EGF receptor homolog known as DER, faint little ball or torpedo (Livneh et al., 1985, Cell 40:599-607; Price et al., 1989, Cell 56:1085-1092; Schejter and Shilo, 1989, Cell 56:1093-1104).
6.3. Materials and Methods
6.3.1. Drosophila Cultures and Strains
Cultures were maintained on standard cornmeal/molasses/agar Drosophila medium supplemented with active dry yeast and were raised at 25.degree. C. The red Ser.sup.D, Df(3R)Ser.sup.+82f24, and Bd.sup.G chromosomes were obtained from Peter Lewis. The red Ser.sup.D chromosome was maintained in homozygous condition. The mutations pll.sup.11, Bd.sup.862.5, and B.sup.43.5 were generously provided by Kathryn Anderson. The Notch duplication CosP479 is an .about.40 kb P-element cosmid construct inserted into the third chromosome (Ramos et al., 1989, Genetics 123:337-348). Other mutations and chromosomes have been described previously (Lindsley and Grell, 1968, Genetic variations of Drosophila melanogaster, Carnegie Inst. Wash. Publ. 627).
6.3.2. Mutagenesis
Males aged 3-7 days and homozygous for the red Ser.sup.D chromosome were irradiated with approximately 4500 R (150 kV, 5 mA, 9.2 min exposure; Torrex 150 Source, Torr X-Ray Corp.) and mated immediately to C(1)A;y/y.sup.2 Y611 or C(1)Dx;yf/y.sup.2 Y611 virgin females. The F.sub.1 males were scored for the absence of he Ser.sup.D wing phenotype and mated to Gl.sup.p1-3 fz red e/Tm2, red e virgin females to establish balanced Ser.sup.rev /Tm2, red e stocks.
Mutations used in this study are shown in Table 1.
6.3.3. Embryonic Phenotype Analysis
Cuticle preparations were according to the protocol 5of Wieschaus and Nusslein-Volhard (1986, in Drosophila. A Practical Approach, (ed. D. B. Roberts), IRL Press, Oxford, pp. 199-227) on embryos aged for a minimum of 24 hours at 25.degree. C. Anti-horseradish peroxidase antibody staining of the embryonic nervous system (Jan and Jan, 1982, Proc. Natl. Acad. Sci. USA 79:2700-2704) was carried out using fluorescein-conjugated antibody (Cappel) as described in Preiss et al. (1988, EMBO J. 7:3917-3927). CNS preparations of torpedo.sup.2C82 were used for comparison studies.
6.3.4. Isolation of Nucleic Acids
Genomic DNA was isolated as described in Pirrotta et al. (1983, EMBO J. 2:927-934). Restriction enzyme cleavage, agarose gel electrophoresis, capillary transfer to nitrocellulose and hybridization conditions were carried out according to standard procedures. DNA probes labeled with .sup.32 P were prepared by random oligonucleotide priming, as described in Feinberg and Vogelstein (1983, Anal. Biochem. 132:6-13).
Stage-specific total RNAs from a Canton-S strain were extracted in guanidinium thiocyanate essentially as described in Chirgwin et al. (1979, Biochem. 18:5294-5299). Pupal and adult RNAs were generously provided by A. Preiss (Preiss et al., 1988, EMBO J. 7:3917-3927). Poly (A).sup.+ RNA was selected by serial passage over oligo(dT)- cellulose (Stratagene) according to Sambrook et al. (1989, Molecular Cloning: A Laboratory Manual, 2d Ed., Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y.) and stored in ethanol. RNA was size fractionated in formaldehyde agarose gels and blotted onto Nytran membrane (Schleicher & Schuell) by capillary transfer. RNA was fixed to the membrane via UV crosslinking.
Two Drosophila genomic phage libraries (Preiss et al., 1985, Nature 313:27-32; R. Karess, unpubl.) were screened and recombinant clones were isolated as described in Benton and Davis (1977, Science 196:180-182). cDNAs in .lambda.gt10 were isolated from the early pupal library of Poole et al. (1985, Cell 40:37-43). We isolated the C1 cDNA using the genomic EGF-like sequences from coordinates +1.5 to +4 (FIG. 2) as probe. Subsequently, we isolated the C3 cDNA using the 5' 700 bp terminal fragment of the C1 cDNA as probe.
6.3.5. Sequencing and Analysis
The EcoRI cDNA inserts from .lambda.gt10 were subcloned directly into Bluescript KS+ and KS- vectors (Stratagene). Single-stranded DNAs were produced according to the manufacturer's instructions. Both strands of the cDNAs were sequenced using the dideoxynucleotide chain-termination procedure (Sanger, et al., 1977, Proc. Natl. Acad. Sci. USA 74:5463-5467) using the Sequenase kit (U. S. Biochemical). Sequence was obtained using the M13 and reverse primers for these vectors. Additional sequence was obtained by generating internal deletions through the use of restriction sites within the Bluescript polylinker and the cDNA inserts. The remaining cDNA sequences that were not accessible by these methods were obtained by using synthetic primers (Research Genetics) complementary to the end of a previously determined sequence.
Sequences were entered by sonic digitizer and overlapping sequence compilation; manipulation, translation, and secondary structure prediction were accomplished by using the Intelligenetics PC-GENE. Open reading frame prediction and plotting were performed using the University of Wisconsin program CODONPREFERENCE (Gribshov et al., 1984, Nucl. Acids Res. 12:539-549). The SITES program (PCGENE) was used to predict the location of the signal sequence, transmembrane domain, EGF-like repeats, and phosphorylation sites.
6.3.6. Whole Mount in Situ Procedure
A modification of the whole-mount in situ procedure of D. Tautz (Procedure 84a in Ashburner, 1989, Drosophila: A Laboratory Manual, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y.) was used. The differences were as follows: Proteinase K (Boehringer-Mannheim) treatment was 10 to 14 minutes; 100 .mu.l (rather than 10 .mu.l) of boiled probe was used; after washing the embryos with 1:4 hybridization buffer to PBT, they were washed twice in PBT for 20 minutes, and then twice in 1.times.PBS, 0.1% BSA (globin free, Sigma), 0.2% Triton-X100 for 20 minutes; the antibody treatment was done in the same PBS, BSA, Triton solution at 4.degree. C. overnight; the embryos were washed four times in the PBS, BSA, Triton solution at room temperature; after the alkaline phosphatase reaction, embryos were dehydrated twice in 70% and 100% ethanol and then cleared in xylenes; the embryos were mounted in Permount (Sigma). Dissected embryos were rehydrated, dissected in PBT, and mounted in 90% glycerol 10% Tris-HCl at pH 8.0, with 0.5% n-propyl-galate (wt/vol; Sigma)!.
The probe was made by runoff of a PCR reaction in 50 mM KCl, 10 mM Tris-HCl (pH 8.3), 1.5 mM MgCl.sub.2, 0.01% (wt/vol) gelatin, 0.2 mM DATP, 0.2 mM dCTP, 0.2 mM dGTP, 0.15 mM dTTP, and 0.07 mM digoxigenin-11-dUTP (Boehringer Mannheim) using 150 ng of custom synthesized primer and approximately 400 ng of linearized DNA. Probe was synthesized from cDNA coordinates 4826 to 3854; the opposite strand constituted the control probe and was synthesized from coordinates 4458 to 5015 (refer to FIG. 5). The conditions for the PCR thermal cycler were 95.degree. C. for 45 seconds, 55.degree. C. for 30 seconds, and 72.degree. C. for 1 minute, which were run for 30 cycles. The probe was ethanol precipitated twice and resuspended in 300 .mu.l of hybridization solution.
7. Expression of a Serrate Fragment as a Fusion Protein and Production of Antibodies Thereto
Mouse anti-Serrate polyclonal antisera were made as follows: A BamHI fragment encoding amino acids 78-425 (FIGS. 3A-3F) was subcloned into the pGEX-1 expression vector (Smith and Johnson, 1988, Gene 67:31-40). Fusion proteins were purified on glutathione-agarose beads (SIGMA), and injected into mice for antibody production. Mouse antisera were precipitated with 50% (NH.sub.4).sub.2 SO.sub.4 and resuspended in PBS (150 mM NaCl, 14 mM Na.sub.2 HPO.sub.4, 6 mM NaH.sub.2 PO.sub.4) with 0.02% NaN.sub.3.
8. Expression of Serrate and a Fragment and a Chimeric Derivative Thereof; Identification of a Notch-Binding Domain
We describe herein the recombinant expression of Serrate, of a deletion construct (fragment) thereof, and of a chimeric Notch-Serrate fragment, and show that the full-length Serrate and the chimeric derivative are capable of binding to Notch in vitro.
8.1. Expression of Serrate and of Derivatives Thereof
For the Serrate expression construct, a synthetic primer containing an artificial BamHI site immediately 5' to the initiator AUG at position 442 of the Drosophila sequence (all sequence numbers are according to Fleming et al., 1990, Genes & Dev. 4:2188-2201) and homologous through position 464, was used in conjunction with a second primer from position 681-698 to generate a DNA fragment of .about.260 base pairs. This fragment was cut with BamHI and KpnI (position 571) and ligated into Bluescript KS+ (Stratagene). This construct, BTSer5'PCR, was checked by sequencing, then cut with KpnI. The Serrate KpnI fragment (571-2981) was inserted and the proper orientation selected, to generate BTSer5'PCR-Kpn. The 5' SacII fragment of BTSer5'PCR-Kpn (SacII sites in Bluescript polylinker and in Serrate (1199)) was isolated and used to replace the 5' SacII fragment of cDNA C1 (Fleming et al., 1990, Genes & Dev. 4:2188-2201), thus regenerating the full length Serrate cDNA minus the 5' untranslated regions. This insert was isolated by a SalI and partial BamHI digestion and shuttled into the BamHI and SalI sites of the metallothionein promoter vector pRmHa-3 (Bunch et al., 1988, Nucl. Acids. Res. 16:1043-1061) to generate the final expression construct, Ser-mtn.
A Serrate deletion expression construct was also made, in which nucleotides 672-1293 (encoding amino acids 77-284) (FIGS. 3A-3F, 7, 8A-8C) were deleted. This deletion construct was made as follows: The Ser-mtn construct was digested with EcoRV, which cuts at nucleotide 672, and with SfiI, which cuts at nucleotide 4073. The linearized vector, lacking the EcoRV-SfiI (672-4073) fragment, was isolated. Plasmid SerFL was then digested with NdeI, which cuts at nucleotide 1289, and treated with mung bean nuclease resulting in the "trimming back" of four bases. The resulting SerFL fragment was then digested with SfiI which cuts at base 4073, and the resulting 1293-4073 fragment was isolated and ligated into the EcoRV-SfiI vector isolated above.
In addition, a Notch-Serrate chimeric construct was made using a clone consisting of Drosophila Notch cDNA with a deletion of all the Notch EGF-like repeats ("AEGF") (see PCT Publication WO 92/19734 published Nov. 12, 1992; Rebay et al., 1991, Cell 67:687-699 (FIGS. 12A-12B, construct no. 25)). An N-terminal region of Serrate with homology to Delta and including the Serrate EGF-like repeats (Serrate nucleotide numbers 676-1287, encoding amino acids 79-282; FIGS. 7, 8A-8C) was placed into the AEGF deletion of Notch. The above constructs were expressed in Drosophila S2 cells. The S2 cell line (Schneider, 1972, J. Embryol. Exp. Morph. 27, 353-365) was grown in M3 medium (prepared by Hazleton Co.) supplemented with 2.5 mg/ml Bacto-Peptone (Difco), 1 mg/ml TC Yeastolate (Difco), 11% heat-inactivated fetal calf serum (FCS) (Hyclone), and 100 U/ml penicillin-100 .mu.g/ml streptomycin-0.25 .mu.g/ml fungizone (Hazleton). Cells growing in log phase at .about.2.times.10.sup.6 cells/ml were transfected with 20 .mu.g of DNA-calcium phosphate coprecipitate in 1 ml per 5 ml of culture as previously described (Wigler et al., 1979, Proc. Natl. Acad. Sci. USA 78, 1373-1376), with the exception that BES buffer (SIGMA) was used in place of HEPES buffer (Chen and Okayama, 1987, Mol. Cell. Biol. 7, 2745-2752). After 16-18 hr, cells were transferred to conical centrifuge tubes, pelleted in a clinical centrifuge at full speed for 30 seconds, rinsed once with 1/4 volume of fresh complete medium, resuspended in their original volume of complete medium, and returned to the original flask. Transfected cells were then allowed to recover for 24 hr before induction. Expression from the metallothionein constructs was induced by the addition of CUS0.sub.4 to 0.7 mM.
8.2. Aggregation Assays for Binding to Notch
8.2.1. Methods
Two types of aggregation assays were used. In the first assay, a total of 3 ml of cells (5-10.times.10.sup.6 cells/ml) was placed in a 25 ml Erlenmeyer flask and rotated at 40-50 rpm on a rotary shaker for 24-48 hr at room temperature. For these experiments, cells were mixed 1-4 hr after induction began and induction was continued throughout the aggregation period. In the second assay, .about.0.6 ml of cells were placed in a 0.6 ml Eppendorf tube (leaving a small bubble) after an overnight induction (12-16 hr) at room temperature and rocked gently for 1-2 hr at 4.degree. C. Ca.sup.2+ dependence experiments were performed using the latter assay. For Ca.sup.2+ dependence experiments, cells were first collected and rinsed in balanced saline solution (BSS) with 11% FCS (BSS-FCS; FCS was dialyzed against 0.9% NaCl, 5 mM Tris pH 7.5!) or in Ca.sup.2+ free BSS-FCS containing 10 mM EGTA (Snow et al., 1989, Cell 59: 313-323) and then resuspended in the same medium at the original volume.
For viewing by immunofluorescence, cells were collected by centrifugation (3000 rpm for 20 seconds in an Eppendorf microcentrifuge) and fixed in 0.6 ml Eppendorf tubes with 0.5 ml of freshly made 2% paraformaldehyde in PBS for 10 min at room temperature. After fixing, cells were collected by centrifugation, rinsed twice in PBS, and stained for 1 hr in primary antibody in PBS with 0.1% saponin (SIGMA) and 1% normal goat serum (Pocono Rabbit Farm, Canadensis, Pa.). Sera were appropriately diluted (e.g., 1:1000) for this step. Cells were then rinsed once in PBS and stained for 1 hr in specific secondary antibodies (double-labeling grade goat anti-rabbit and goat anti-mouse), in PBS-saponin-normal goat serum. After this incubation, cells were rinsed twice in PBS and mounted on slides in 90% glycerol, 10% 1M Tris (pH 8.0), and 0.5% n-propyl gallate. Cells were viewed under epifluorescence on a Leitz Orthoplan 2 microscope.
Confocal micrographs were taken using the Bio-Rad MRC 500 system connected to a Zeiss Axiovert compound microscope. Images were collected using the BHS and GHS filter sets, aligned using the ALIGN program, and merged using MERGE. Fluorescent bleed-through from the green into the red channel was reduced using the BLEED program (all software provided by Bio-Rad). Photographs were obtained directly from the computer monitor using Kodak Ektar 125 film.
Notch-expressing cells for the assays were obtained similarly, using metallothionein promoter-driven plasmid constructions containing D. melanogaster Notch (see PCT Publication WO 92/19734 published Nov. 12, 1992; Fehon et al., 1990, Cell 61:523-534; Rebay et al., 1991, Cell 67:687-699).
8.2.2. Results
We found that Serrate expressing cells adhere to Notch expressing cells in a calcium dependent manner (see also Rebay et al., 1991, Cell 67:687-699). However, unlike Delta, under the experimental conditions tested, Serrate did not appear to interact homotypically. In addition, we detect no interactions between Serrate and Delta. It is possible that such interactions do occur, but at an affinity such that they are below the level of detection in our assay system.
We have tested a subset of our Notch deletion constructs to map the Serrate-binding domain and have found that Notch EGF-like repeats 11 and 12, in addition to binding to Delta, also mediate interactions with Serrate. In addition, the Serrate-binding function of these repeats also appears to have been conserved in the corresponding two EGF repeats of Xenopus Notch (construct #33.DELTA.Cla+XEGF(10-13); see Rebay et al., supra).
We were also able to define the Serrate region which is essential for the Notch/Serrate aggregation. Deleting nucleotides 672-1293 (i.e. amino acids 77-284) eliminated the ability of the Serrate protein to aggregate with Notch. While both cells expressing Notch and cells expressing the Serrate fragments were detected by immunofluorescence with anti-Notch and anti-Serrate antibodies, respectively, these cells did not co-aggregate.
Aggregation assays with cells expressing Notch and cells expressing the chimeric AEGF Notch-Serrate construct showed binding between Notch and the chimeric construct. These experiments thus demonstrated that a fragment of Serrate consisting of amino acids 79-282 (see SEQ ID NO:2) is capable of mediating binding to Notch. Similar experiments with Delta from the laboratory of M. Muskavitch (personal communication) have demonstrated that the homologous region of Delta (without the partial EGF-like repeat) was sufficient to mediate Notch-Delta binding. Therefore, it is likely that the partial EGF-like repeat of Serrate is not essential for this binding to occur.
Work in our laboratory has shown that Notch and Delta proteins interact directly at the molecular level (Fehon et al., 1990, Cell 61:523-534; International Publication No. WO 92/19734 published Nov. 12, 1992; collectively incorporated by reference herein in their entireties), as demonstrated by the specific binding of Notch-expressing cells to Delta-expressing cells in vitro. We have also shown that EGF-like repeats repeats 11 and 12 of Notch are required and sufficient for Notch-Delta-mediated aggregation, and that Delta participates in heterotypic (Delta-Notch) and homotypic (Delta-Delta) interactions mediated by its amino-terminus (id.). Thus, it is conceivable that the Serrate and Delta proteins compete for binding with the Notch protein. Such interplay could underlie the genetic interactions observed between Notch and Serrate.
Notch and Serrate appeared to aggregate less efficiently than Notch and Delta, perhaps because the Notch-Serrate interaction is weaker. For example, when scoring Notch-Delta aggregates, we detect .about.40% of all Notch expressing cells in clusters with Delta expressing cells and .about.40% of all Delta expressing cells in contact with Notch expressing cells. For Notch-Serrate, we find only .about.20% of all Notch expressing cells and -15% of all Serrate expressing cells in aggregates. For the various Notch deletion constructs tested, we consistently detect a reduction in the amount of aggregation between Notch and Serrate as compared to the corresponding Notch-Delta levels, with the possible exception of two constructs which exhibit severely reduced levels of aggregation even with Delta. One trivial explanation for this reduced amount of aggregation could be that our Serrate construct simply does not express as much protein at the cell surface as the Delta construct, thereby diminishing the strength of the interaction. Alternatively, the difference in strength of interaction may indicate a fundamental functional difference between Notch-Delta and Notch-Serrate interactions that may be significant in vivo.
9. Isolation and Characterization of a Mouse Serrate Homolog
A mouse Serrate homolog, termed M-Serrate-1, was isolated as follows:
Mouse Serrate-1 gene
Tissue origin: 10.5-day mouse embryonic RNA
Isolation method:
a) random primed cDNA against above RNA
b) PCR of above cDNA using
PCR primer 1: CGI(C/T)TTTGC(C/T)TIAA(A/G)(G/C)AITA(C/T)CA (SEQ ID NO: 11) {encoding RLCCK(H/E)YQ (SEQ ID NO:12)}:
PCR primer 2: TCIATGCAIGTICCICC(A/G)TT (SEQ ID NO:13) {encoding NGGTCID (SEQ ID NO:14)}
Amplification conditions: 50 ng cDNA, 1 .mu.g each primer, 0.2 mM dNTP's, 1.8 U Taq (Perkin-Elmer) in 50 .mu.l of supplied buffer, 40 cycles of: 94.degree. C./30 sec, 45.degree. C./2 min, 72.degree. C./1 min extended by 2 sec each cycle.
Yielded a 1.8 kb fragment which was sequenced at both ends and identified as corresponding to C-Serrate-1
Partial DNA sequence of M-Serrate-1:
From 5' end: ##STR1## Protein translation of above: SRVTAGGPCSFGSGSTPVIGGNTFNLKASRGNDRNRIVLPFSFTWPRSYTLLVE
(SEQ ID NO:16) (corresponds to amino-terminal sequence upstream of the DSL domain)
From 3' end (but coding strand) ##STR2## Protein translation of above: SSNVCGPHGKCKSQSAGKFTCDCNKGFTGTYCHENINDCESNPCK (SEQ ID NO:18)
(within tandemly arranged EGF-like repeats)
Expression pattern: The expression pattern was determined to be the same as that observed for C-Serrate-1 (chicken Serrate) (see Section 11 infra), including expression in the developing central nervous system, peripheral nervous system, limb, kidney, lens, and vascular system.
10. Isolation and Characterization of a Xenopus Serrate Homolog
A Xenopus Serrate homolog, termed Xenopus Serrate-1 was isolated as follows:
5 Xenopus Serrate-1 gene
Tissue origin: neurula-stage embryonic RNA
Isolation method:
a) random primed cDNA against above RNA
b) PCR using:
Primer 1: CGI(C/T)TTTGC(C/T)TIAA(A/G)(G/C)AITA(C/T)CA (SEQ ID NO:11) {encoding RLCCK(H/E)YQ (SEQ ID NO:12)}:
PCR primer 2: TCIATGCAIGTICCICC(A/G)TT (SEQ ID NO:13) {encoding NGGTCID (SEQ ID NO:14)}
Amplification conditions: 50 ng cDNA, 1 .mu.g each primer, 15 0.2 mM dNTP's, 1.8 U Taq (Perkin-Elmer) in 50 .mu.l of supplied buffer. 40 cycles of: 94.degree. C./30 sec, 45.degree. C./2 min, 72.degree. C./1 min extended by 2 sec each cycle.
Yielded a .about.700 bp fragment which was partially sequenced to confirm its relationship to C-Serrate-1.
11. Isolation and Characterization of a Chick Serrate Homolog
In the example herein, we report the cloning and sequence of a chick Serrate homolog, C-Serrate, and of fragments of two chick Notch homologs, C-Notch-1 and C-Notch-2, together with their expression patterns during early embryogenesis. The patterns of transcription of C-Serrate overlaps with that of C-Notch-1 in many regions of the embryo, suggesting that C-Notch-1, like Notch in Drosophila, is a receptor for Serrate. In particular, Notch and Serrate are expressed in the neurogenic regions of the developing central and peripheral nervous system.
Our data show that Serrate, a known ligand of Notch, has been conserved from arthropods to chordates. The overlapping expression patterns suggest conservation of its functional relationship with Notch and imply that development of the chick and in particular of its central nervous system involves the interaction of C-Notch-1 with Serrate at several specific locations.
Materials and Methods
Embryos
White Leghorn chicken eggs were obtained from University Park Farm and incubated at 38.degree. C. Embryos were staged according to Hamburger and Hamilton (1951, J. Exp. Zool. 88:49-92).
Cloning of chicken homologs of Notch
Approximately 1000 base pair PCR fragments of the chicken Notch 1 and Notch 2 genes were amplified from otic explant RNA (see below) using degenerate primers and PCR conditions as outlined in Lardelli and Lendahl (1993, Exp. Cell Res. 204:364-372). The PCR fragment was subcloned into Bluescript KS-, sequenced and used as a template for making a DIG antisense RNA probe (RNA Transcription Kit, Stratagene; DIG RNA labelling mix, Boehringer Mannheim).
Cloning of a chicken homologue of Drosophila Serrate
Otic explants were dissected from embryos of stages 8 to 13. Each otic explant consisted of the two otic cups, a short section of intervening hindbrain and pharynx and the associated head ectoderm and mesenchyme. RNA was extracted using a modification of standard protocols (Sambrook et al., 1989, in Molecular Cloning: A Laboratory Manual, 2nd ed., Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y.) and polyA.sup.+ mRNA was isolated from total RNA using the PolyATtract mRNA Isolation System (Promega). First strand cDNA was synthesized using the SuperScript Preamplification System (Gibco).
PCR and degenerate primers were used to amplify a fragment of a chicken gene homologous to the Drosophila gene Serrate from the otic explant cDNA. The primers were designed to recognize peptide motifs found in both the fly Delta and Serrate proteins:
1) primer 1, 5-CGI(T/C)TITGC(T/C)TIAA(G/A)(G/C)AITA(C/T)CA-3'(SEQ ID NO:19), corresponds to the motif RLCLK(E/H)YQ (SEQ ID NO:20) located at the amino-terminus of the fly Delta and Serrate proteins.
2) primer 2, 5'-TCIATGCAIGTICCICC(A/G)TT-3'(SEQ ID NO:13), corresponds to the motif NGGTCID (SEQ ID NO:14) found in several of the EGF-like repeats. The PCR conditions were as follows: 35 cycles of 94.degree. C. for 1 minute, 45.degree. C. for 1.5 minutes and 72.degree. C. for 2 minutes; followed by a final extension step of 72.degree. C. for 10 minutes. A PCR product of approximately 900 base pairs in length was purified, subcloned into Bluescript KS-(Stratagene) and its DNA sequence partially determined to confirm that it was a likely Serrate homolog. It was then used to recover larger cDNA clones by screening two cDNA libraries:
1) a stage 8-13 otic explant random primed cDNA library
2) a stage 17 chick spinal cord oligo dT primed cDNA library Overlapping cDNAs were isolated, and two (termed 9 and 3A.1) that together cover almost the entire coding region of the gene were subcloned into Bluescript KS-. DNA sequence was determined from nested deletion series generated using the double-stranded Nested Deletion Kit (Pharmacia) and Sanger dideoxy chain termination method with the Sequenase enzyme (US Biochemical Corporation). Sequences were aligned and analyzed using Geneworks 2.3 and Intelligenetics. Homology searches were done using the program Sharq.
To obtain the most 5' end of the open reading frame, a number of other PCR based strategies were used including the screening of a number of other libraries (cDNA and genomic) using the method of Lardelli et al. (1994, Mechanisms of Development 46:123-136).
In situ hybridization
Patterns of gene transcription were determined by in situ hybridization using DIG-labelled RNA probes and:
1) a high-stringency wholemount in situ hybridization protocol, and
2) in situ hybridization on cryostat sections based on the protocol of Strahle et al. (1994, Trends in Genet. 10:7).
Results
To obtain insight into the likely role of chick Serrate in the vertebrate embryo, we examined its expression in relation to that of chick Notch, since functional coupling of Notch and Serrate occurs in Drosophila. Two chick Notch homologs were obtained as described below.
C-Notch-1 and C-Notch-2 are apparent counterparts of the rodent Notch-1 and Notch-2 genes, respectively
We searched for Notch homologs in the chick by PCR, using cDNA prepared from two-day chick embryos and degenerate primers based on conserved regions common to the known rodent Notch homologs. In this way, we obtained fragments, each approximately 1000 nucleotides long, of two distinct genes, which we have called C-Notch-1 and C-Notch-2. The fragments extend from the third Notch/lin12 repeat up to and including the last five or so EGF-like repeats. EGF-like repeats are present in a large number of proteins, most of which are otherwise unrelated to Notch. The three Notch/lin12 repeats, however, are peculiar to the Notch family of genes and are found in all its known members. C-Notch-1 shows the highest degree of amino-acid identity with rodent Notch1 (Weinmaster et al., 1991, Development 113:199-205), and is expressed in broadly similar domains to rodent Notch1 (see below). Of the rodent Notch genes, C-Notch-2 appears most similar to Notch2 (Weinmaster et al., 1992, Development 116:931-941).
We examined the expression patterns of C-Notch-1 in early embryos by in situ hybridization. C-Notch-1 was expressed in the 1- to 2-day chick embryo in many well-defined domains, including the neural tube, the presomitic mesoderm, the nephrogenic mesoderm (the prospective mesonephros), the nasal placode, the otic placode/vesicle, the lens placode, the epibranchial placodes, the endothelial lining of the vascular system, in the heart, and the apical ectodermal ridges (AER) of the limb buds. These sites match the reported sites of Notch1 expression in rodents at equivalent stages (Table II). Taking the sequence data together with the expression data, we conclude that C-Notch-1 is either the chick ortholog of rodent Notch1, or a very close relative of it.
C-Serrate is a homolog of Drosophila Serrate, and codes for a candidate ligand for a receptor belonging to the Notch family
In Drosophila, two ligands for Notch are known, encoded by the two related genes Delta and Serrate. The amino-acid sequences corresponding to these genes are homologous at their 5' ends, including a region, the DSL motif, which is necessary and sufficient for in vitro binding to Notch. To isolate a fragment of a chicken homolog of Serrate, we used PCR and degenerate primers designed to recognize sequences on either side of the DSL motif (see Materials and methods). A 900 base pair PCR fragment was recovered and used to screen a library, allowing us to isolate overlapping cDNA clones. The DNA sequence of the cDNA clones revealed an almost complete single open reading frame of 3582 nucleotides, lacking only a few 5' bases. Comparison with the amino acid sequences of Drosophila Delta and Serrate suggests that we are missing only the portion of the coding sequence that encodes part of the signal sequence of the chick Serrate protein.
Translation of the nucleotide sequence (SEQ ID NO:9) (FIGS. 11A-11B) predicts a protein of 1230 amino acids (SEQ ID NO:10) (FIGS. 12A-12B). A hydropathy plot reveals a single hydrophobic region characteristic of a transmembrane domain (Kyte and Doolittle, 1982, J. Mol. Biol. 157:105-132). In addition, the protein has sixteen EGF-like repeats organized in a tandem array in its extracellular domain. Comparison of the chick sequence with sequences of D.melanogaster Delta and Serrate suggests that the clones encode a chicken homolog of Serrate (FIG. 13; FIG. 14). Whereas Drosophila Serrate contains 14 EGF-like repeats with large insertions in repeats 4, 6 and 10, the chicken homolog has an extra two EGF-like repeats and only one small insertion of 16 amino acids in the 10th repeat. Both proteins have a second cysteine-rich region between the EGF-like repeats and the transmembrane domain; the spacing of the cysteines in this region is almost identical in the two proteins (compare CX.sub.2 CXCX.sub.6 CX.sub.4 CX.sub.15 CX.sub.5 CX.sub.7 CX.sub.4 CX.sub.5 C in Drosophila Serrate with CX.sub.2 CXCX.sub.6 CX.sub.4 CX.sub.9 CX.sub.5 CX.sub.7 CX.sub.4 CX.sub.5 C in C-Serrate). The intracellular domain of C-Serrate bears no significant homology to the intracellular domains of either Drosophila Delta or Serrate.
C-Serrate is expressed in the central nervous system, cranial placodes, nephric mesoderm, vascular system, and limb bud mesenchyme
In situ hybridization was to examine the expression of C-Serrate in whole-mount preparations during early embryogenesis, from stage 4 to stage 21, at intervals of roughly 12 hours. Later stages were studied by in situ hybridization on cryosections.
The main sites of early expression of C-Serrate, as seen in whole mounts, can be grouped under five headings: central nervous system, cranial placodes, nephric mesoderm, vascular system, and limb bud mesenchyme.
Central nervous system
The first detectable expression of C-Serrate was seen in the central nervous system at stage 6 (0 somites/24 hrs), within the posterior portion of the neural plate. By stage 10 (9-11 somites/35.5 hrs), a strong stripe of expression was seen in the prospective diencephalon. Additional faint staining was seen in the hindbrain and in the prospective spinal cord.
At stage 13, there were several patches of expression in the neural tube. In the diencephalon, there was a strong triangular stripe of expression that appeared to correspond to neuromere D2. There were two patches (one on either side of the midline) on the floor of the anterior mesencephalon as well as diffuse staining in the dorsal mesencephalon. In the hindbrain and rostral spinal cord, there were two longitudinal stripes of expression on either side of the midline: one along the dorsal edge of the neural tube and a second more ventral one, adjacent to the floor plate. Both were located within the domain of (rat) Notch 1 expression. The anterior limit of the ventral stripe was at the midbrain/hindbrain boundary. The dorsal stripe was continuous with the expression in the dorsal mesencephalon. In the anterior spinal cord, expression was more spotty, the stripes being replaced by isolated scattered cells expressing C-Serrate.
At stage 17 (58 hrs), expression in the diencephalon and midbrain was unchanged. In the hindbrain and spinal cord, there were an additional two longitudinal stripes: one midway along the dorsoventral axis and a second wider more ventral stripe; the anterior limits of these stripes coincided with the anterior border of rhombomere 2. All four longitudinal stripes in the hindbrain continued into the spinal cord of the embryo; decreasing towards its posterior end. These stripes of expression were maintained at least up to and including stage 31 (E7). By stage 21 (84 hrs), additional expression was seen in the cerebral hemispheres and strong expression in a salt and pepper distribution of cells in the optic tectum.
Cranial placodes
It is striking that C-Serrate is expressed in all the cranial placodes--the lens placode, the nasal placode, the otic placode/vesicle and the epibranchial placodes, as well as a patch of cranial ectoderm anterior to the otic placode that may correspond to the trigeminal placode (which is not well-defined morphologically).
In the lens placode, expression was already seen at stage 11, rapidly became very strong, and persisted at least to stage 21. Expression was weaker in the nasal placode and was only detected from stage 13. Again, expression was maintained at least until stage 21.
Likewise for the otic placode, expression began to be visible at stage 10 and was strong by early stage 11 (12-14 somites, 42.5 hours). Curiously, there was a "hole" in the otic expression domain--an anteroventral region of the placode in which the gene was not expressed. Subsequently, as the placode invaginates to form an otic vesicle, the strongest expression was seen at the anterolateral and posteromedial poles. Later still, as the otic vesicle becomes transformed into the membranous labyrinth of the inner ear, C-Serrate expression became restricted to the sensory patches.
The epibranchial expression was seen at stage 13/14 as strong staining in the ectoderm around the dorsal margins of the first and second branchial clefts. It was accompanied by expression of the gene in the deep part of the lining of the clefts and in the endodermal lining of the branchial pouches, where the two epithelia abut one another.
Lastly, a large and strong but transient patch of expression was seen in the cranial ectoderm just anterior and ventral to the ear rudiment at stage 11. From its location, we suspect this to be, or to include, the region of the trigeminal placode.
Nephric mesoderm
Expression was detectable in the cells of the intermediate mesoderm from stage 10 and in older embryos (stage 17 to 21) in the developing mesonephric tubules.
Limb buds
C-Serrate mRNA was localized to a patch of mesenchyme at the distal end of the developing limb bud. This may suggest a role in limb growth.
Other sites
Expression was also seen in the tail bud, allantoic stalk, and possibly other tissues at late stages.
All major sites of C-Serrate expression lie within domains of C-Notch-1 expression
The conservation of the DSL domain and adjacent N-terminal region in C-Serrate suggests that it functions as a ligand for a receptor belonging to the Notch family. We thus expected to find sites where C-Serrate expression is accompanied by expression of a Notch gene. At such sites, overlapping or contiguous expression of the two genes can be taken as an indication that cells are communicating by Serrate-Notch signalling. We have compared the expression pattern of C-Serrate, as shown by in situ hybridization, with that of C-Notch-1 , to discover what overlaps in fact occur, over a range of stages up to 8 days of incubation (E8). All the observed sites of C-Serrate expression indeed lay within, or very closely adjacent to, domains of expression of C-Notch-1 (Table III).
Because of the importance of Notch and its partners in insect neurogenesis, it was of particular interest to us to see whether the homologous genes are involved in the development of the vertebrate CNS. C-Serrate is expressed in the CNS, and its pattern of expression shows a remarkable relationship to that of the Notch homologs.
We analyzed transverse sections through the spinal cord of a six day chicken embryo hybridized with C-Notch-1 and C-Serrate antisense RNA probes. C-Notch-1 was expressed throughout the luminal region as described previously; within this region, there were two small patches in which Serrate was strongly expressed.
Discussion
In Drosophila development, cell-cell signalling via the product of the Notch gene plays a cardinal role in the final cell-fate decisions that specify the detailed pattern of differentiated cell types. This signalling pathway, in which the Notch protein has been identified as a transmembrane receptor, is best known for its role in neurogenesis: loss-of-function mutations in Notch or any of a set of other genes required for signal transmission via Notch alter cell fates in the neuroectoderm, causing cells that should have remained epidermal to become neural instead. Notch-dependent signalling is, however, as important in non-neural as in neural tissues. It regulates choices of mode of differentiation in oogenesis, in myogenesis, in formation of the Malpighian tubules and in the gut, for example, as well as in development of the retina, the peripheral sensilla, and the central nervous system. In most of these cases the signal delivered via Notch appears to mediate lateral inhibition, a type of interaction by which a cell that becomes committed to differentiate in a particular way--for example, as a neuroblast--inhibits its immediate neighbors from doing likewise. This forces adjacent cells to behave in contrasting ways, creating a fine-grained pattern of different cell types.
There are, however, good reasons to believe that this is not the only function of signals delivered via Notch. Two direct ligands of Notch have been identified. These are the products of the Delta and Serrate genes. Both of them, like Notch itself, code for transmembrane proteins with tandem arrays of EGF-like repeats in their extracellular domain. Both the Delta and the Serrate protein have been shown to bind to Notch in a cell adhesion assay, and they share a large region of homology at their amino-termini including a motif that is necessary and sufficient for interaction with Notch in vitro, the so-called EBD or DSL domain. Yet despite these biochemical similarities, they seem to have quite different developmental functions. Although Serrate is expressed in many sites in the fly, it is apparently required only in the humeral, wing and halteres disks. When Serrate function is lost by mutation, these structures fail to grow. Studies on the wing disc have indicated that it is specifically the wing margin that depends on Serrate; when Serrate is lacking, this critical signaling region and growth centre fails to form, and when Serrate is expressed ectopically under a GAL4-UAS promoter in the ventral part of the wing disc, ectopic wing margin tissue is induced, leading to ectopic outgrowths. Notch appears to be the receptor for Serrate at the wing margin, since some mutant alleles of Notch cause similar disturbances of wing margin development and allele-specific interactions are seen in the effects of the two genes.
Here we describe the identification and full length sequence of a homolog of the Drosophila gene Serrate, and identification and partial sequence of chick homologs of rat/mouse Notch1 and Notch2.
Within the chick Serrate cDNA there is a single open reading frame predicted to encode a large transmembrane protein with 16 EGF repeats in its extracellular domain. It has a well conserved DSL motif suggesting that it would interact directly with Notch. The intracellular domain of chick Serrate exhibits no homology to anything in the current databases including the intracellular domains of Drosophila Delta and Serrate. It should he pointed out however that the intracellular domains of chick and human Serrate (see Section 12) are almost identical.
The spatial distributions of C-Notch-1 and C-Serrate were investigated during early embryogenesis by in situ hybridization. C-Notch-1 and C-Serrate exhibit dynamic and complex patterns of expression including several regions in which they are coexpressed (CNS, ear, branchial region, lens, heart, nasal placodes and mesonephros). The overlapping expression together with the finding that C-Serrate has a well conserved Notch binding domain suggests that this receptor/ligand interaction has been conserved from Drosophila through to vertebrates.
In Drosophila, the Notch receptor is quite widely distributed and its ligands are found in overlapping but more restricted domains. In the chick a similar situation is observed.
Fly Notch is necessary for many steps in the development of Drosophila; its role in lateral inhibition especially in the development of the central nervous system and peripheral sense organs being the best studied examples. However, Notch is a multifunctional receptor and can interact with different signalling molecules (including Delta and Serrate) and in developmental processes that do not easily fit within the framework of lateral inhibition. While available evidence implicates Delta as the signalling molecule in lateral inhibition there is no data to suggest that Serrate participates in lateral inhibition. Rather, Serrate appears to be necessary for development of the dorsal imaginal discs of the larva; that is, the humeral, haltere and wing discs. In the latter, the best studied of these processes, Serrate and Notch are important for the development of the dorsoventral wing margin, a structure necessary for the organization of wing development as a whole.
That C-Serrate has a significant function can be inferred from the conservation of its sequence, in particular, of its Notch-binding domain. The expression patterns reported for C-Serrate in this paper provide the following information. First, since the Serrate gene is expressed in or next to sites where C-Notch-1 is expressed (possibly in conjunction with other Notch homologs), it is highly probable that C-Serrate exerts its action by binding to C-Notch-1 (or to another chick Notch homolog with a similar expression pattern). Second, the expression in the developing kidney, the vascular system and the limb buds might reflect an involvement in inductive signalling between mesoderm and ectoderm, which plays an important part in the development of all these organs. In the limb buds, for example, C-Serrate is expressed in the distal mesoderm, and C-Notch-1 is expressed in the overlying apical ectodermal ridge, whose maintenance is known to depend on a signal from the mesoderm below. In the cranial placodes, a similar role is possible, but the evidence for inductive signalling is weaker, and C-Serrate may equally be involved in communications between cells within the placodal epithelium, for example, in regulating the specialized modes of differentiation of the placodal calls.
What might C-Serrate's function be within the curiously restricted domains of its expression in the CNS? One possibility is that it is involved in regulating the production of oligodendrocytes, which have likewise been reported to originate from narrow bands of tissue extending along the cranio-caudal axis of the neural tube.
12. Isolation and Characterization of Human Serrate Homologs
Clones for the human Serrate sequence were obtained as described below.
The polymerase chain reaction (PCR) was used to amplify DNA from a human placenta cDNA library. Degenerate oligonucleotide primers used in this reaction were designed based on amino-terminal regions of high homology between Drosophila Serrate and Drosophila Delta (see FIG. 13); this high homology region is in the 5' "DSL" domain, that is believed to code for the Notch-binding portion of Delta and Serrate. Two PCR products were isolated and used, one a 350 base-pair fragment, and one a 1.2 kb fragment. These PCR fragments were labelled with .sup.32 P and used to screen a human fetal brain cDNA library. The library used was a commercial library (available from Stratagene) made from a 17-18 week old fetus, in which the cDNAs were inserted into the EcoRI site of a .lambda.-Zap vector. The 1.2 kb fragment hybridized to a single clone out of 106 screened. We rescued this fragment from the .lambda. DNA by converting the isolated phage .lambda. clone to a plasmid via the manufacturer's instructions, yielding the Serrate-homologous cDNA as an insert in the EcoRI site of the vector Bluescript KS- (Stratagene). This plasmid was termed "pBS39". The isolated cDNA was 6464 bases long and contained a complete open reading frame as well as 5' and 3' untranslated regions (FIGS. 9A-9G). Sequencing was carried out using the Sequenase.RTM. sequencing system (U.S. Biochemical Corp.) on 5 and 6% Sequagel acrylamide sequencing gels.
The 350 bp fragment hybridized with two clones, one about 3.1 kb and one about 1.5 kb, called pBS15 and pBS14, respectively. These were isolated, rescued from the .lambda. cDNA, and sequenced as above. pBS14 turned out to contain sequence internal to and identical with pBS15, and was not characterized further. pBS15 contained the start site for the deduced amino acid, and about 3 kb of open reading frame. pBS15 was then labelled with 32P and used to screen another human fetal brain library (from Clontech), made from a week 25-26 fetus, containing the cDNAs cloned into the EcoRI site of .lambda.gt11. Three positive clones were identified. To isolate the cDNAs, .lambda.gt11 DNA was prepared from a liquid lysate, purified over a DEAE column and cut with EcoRI to isolate the human cDNAs. These isolated fragments were subcloned into the EcoRI site of Bluescript KS-. They were called pBS3-15, pBS3-2, and pBS3-20. Two of these cDNAs contained sequences that partially overlapped with pBS15. One of these, pBS3-2, extended from about bp 1200 of pBS15 to the end of the cDNA, including the polyA tail. pBS20 contained sequences internal to and identical with pBS3-2 and was not characterized further. (pBS3-15 turned out to be a piece of the Bluescript vector.) Alignment of the deduced amino acid sequence (SEQ ID NO:8) of the "complete" cDNA (SEQ ID NO:7) generated on the computer with the deduced amino acid sequence from pBS39 (SEQ ID NO:6) showed a gap of about 160 bases and a frame-shift between the putative signal sequence and the beginning of the DSL domain (FIGS. 10A-10E). This missing region probably resulted from a cloning artifact in the construction of the Stratagene library.
The human Serrate cDNA homolog from pBS39 has thus been completely sequenced and contains the complete coding sequence for the gene product. The nucleotide (SEQ ID NO:5) and protein (SEQ ID NO:6) sequences are shown in FIGS. 9A-9G. The nucleotide sequence of homolog 39 was translated using MacVector software (International Biotechnology Inc., New Haven, Conn.). The coding region consists of nucleotide numbers 371-4024 of SEQ ID NO:5. The Protean protein analysis software program from DNAStar (Madison, Wis.) was used to predict signal peptide and transmembrane regions (based on hydrophobicity). The signal peptide was predicted to consist of amino acids 14-29 of SEQ ID NO:6 (encoded by nucleotide numbers 410-457 of SEQ ID NO:5), whereby the amino terminus of the mature protein was predicted to start with Gly at amino acid number 30. The transmembrane domain was predicted to be amino acid numbers 1069-1091 of SEQ ID NO:6, encoded by nucleotide numbers 3575-3643 of SEQ ID NO:5. The consensus (DSL) domain, the region of homology with Drosophila Delta and Serrate, predicted to mediate binding with Notch (in particular, Notch ELR 11 and 12), spans amino acids 185-233 of SEQ ID NO:6, encoded by nucleotide numbers 923-1069 of SEQ ID NO:5. Epidermal growth factor-like (ELR) repeats in the amino acid sequence were identified by eye; 15 (full-length) ELRs were identified and 3 partial ELRs as follows:
ELR 1: amino acid numbers 234-264
ELR 2: amino acid numbers 265-299
ELR 3: amino acid numbers 300-339
ELR 4: amino acid numbers 340-377
ELR 5: amino acid numbers 378-415
ELR 6: amino acid numbers 416-453
ELR 7: amino acid numbers 454-490
ELR 8: amino acid numbers 491-528
ELR 9: amino acid numbers 529-566
Partial ELR: amino acid numbers 567-598
Partial ELR: amino acid numbers 599-632
ELR 10: amino acid numbers 633-670
ELR 11: amino acid numbers 671-708
ELR 12: amino acid numbers 709-747
ELR 13: amino acid numbers 748-785
ELR 14: amino acid numbers 786-823
ELR 15: amino acid numbers 824-862
Partial ELR: amino acid numbers 863-879
Partial ELR: amino acid numbers 880-896
The total ELR domain is thus amino acid numbers 234-896 (encoded by nucleotide numbers 1070-3058 of SEQ ID NO:5). The extracellular domain is thus predicted to be amino acid numbers 1-1068 of SEQ ID NO:6, encoded by nucleotide numbers 371-3574 of SEQ ID NO:5 (amino acid numbers 30-1068 in the mature protein; encoded by nucleotide numbers 458-3574 of SEQ ID NO:5). The intracellular (cytoplasmic) domain is thus predicted to be amino acid numbers 1092-1218 of SEQ ID NO:6, encoded by nucleotide numbers 3644-4024 of SEQ ID NO:5.
Expression constructs are made using the isolated clone(s). The clone is excised from its vector as an EcoRI restriction fragment(s) and subcloned into the EcoRI restriction site of each of the three pGEX vectors (Glutathione S-Transferase expression vectors; Smith and Johnson, 1988, Gene 7:31-40). This allows for the expression of the human Serrate protein product from the subclone in the correct reading frame.
13. Deposit of Microorganisms
Bacteria strain XL1-Blue containing plasmid SerFL, containing an EcoRI fragment encoding a full-length Drosophila Serrate, was deposited on Dec. 11, 1991 with the American Type Culture Collection, 1201 Parklawn Drive, Rockville, Md. 20852, under the provisions of the Budapest Treaty on the International Recognition of the Deposit of Microorganisms for the Purposes of Patent Procedures, and assigned Accession No. 68876.
Plasmid pBS39, containing an EcoRI fragment encoding a full-length human Serrate, was deposited on Feb. 28, 1995 with the American Type Culture Collection, 1201 Parklawn Drive, Rockville, Md. 20852, under the provisions of the Budapest Treaty on the International Recognition of the Deposit of Microorganisms for the Purposes of Patent Procedures, and assigned Accession No. 97068.
Plasmid pBS15, containing a 3.1 kb EcoRI fragment encoding the amino terminus of Human Serrate, cloned into the EcoRI site of Bluescript KS-, was deposited on Mar. 5, 1996 with the American Type Culture Collection, 1201 Parklawn Drive, Rockville, Md. 20852, under the provisions of the Budapest Treaty on the International Recognition of the Deposit of Microorganisms for the Purposes of Patent Procedures, and assigned Accession No. 97459.
Plasmid pBS3-2 containing an 3.2 kb EcoRI fragment encoding the carboxy terminus of Human Serrate, cloned into the EcoRI site of Bluescript KS-, was deposited on Mar. 5, 1996 with the American Type Culture Collection, 1201 Parklawn Drive, Rockville, Md. 20852, under the provisions of the Budapest Treaty on the International Recognition of the Deposit of Microorganisms for the Purposes of Patent Procedures, and assigned Accession No. 97460.
The present invention is not to be limited in scope by the microorganisms deposited or the specific embodiments described herein. Indeed, various modifications of the invention in addition to those described herein will become apparent to those skilled in the art from the foregoing description and accompanying figures. Such modifications are intended to fall within the scope of the appended claims. Various references are cited herein, the disclosures of which are incorporated by reference in their entireties.