US 2026/0137784 A1Application
HUMANIZED GUCY2C T CELL-ANTIGEN COUPLERS AND USES THEREOF
Publication Date:2026-05-21
•47 Claims
•23 Drawing Sheets
Abstract
GUCY2C T cell antigen coupler (TAC) polypeptides having (i) an antigen-binding domain that binds GUCY2C (e.g., a nanobody), (ii) an antigen-binding domain that binds a protein associated with a TCR complex, and (iii) a T cell receptor signaling domain polypeptide are provided.
Metadata
Assignee
- Triumvira Immunologics USA, Inc.
Inventors
- Andreas Bader
- Christopher W. Helsen
- Philbert Ip
- Stacey X. Xu
- Tania Benatar
- Thanyashanthi Nitya-Nootan
Application Information
Application Number:US 19/145,879
Filing Date:2024-01-05
Priority Date:2023-01-06
Classifications
IPC:
A61K40/42A61K40/11A61K40/32A61P35/00C07K14/725C07K16/28
Patent Drawings (23 sheets)
Description
CROSS-REFERENCE TO RELATED APPLICATIONS
[0001] This application claims the benefit of and priority to U.S. Provisional Patent Application No. 63/478,862 filed on Jan. 6, 2023 and U.S. Provisional Patent Application No. 63/594,831 filed Oct. 31, 2023, the entire contents of each of which are hereby incorporated by reference herein in its entirety for all purposes.
SUMMARY
[0002] Disclosed herein, in certain embodiments, are GUCY2C (Guanylate Cyclase 2C) T cell-antigen coupler (GUCY2C-TAC) polypeptides, nucleic acids encoding the GUCY2C-TACs. T cells comprising the GUCY2C-TACs, and methods of use thereof.
[0003] Disclosed herein, in certain embodiments, is a Guanylate Cyclase 2C (GUCY2C) T cell-antigen coupler (GUCY2C-TAC) protein, comprising: (a) a first polypeptide comprising a GUCY2C-binding domain comprising: (i) a CDR1 having the amino acid sequence of SEQ ID NO: 72, a CDR2 having the amino acid sequence of SEQ ID NO: 73, and a CDR3 having the amino acid sequence of SEQ ID NO: 74; or (ii) a CDR1 having the amino acid sequence of SEQ ID NO: 75, a CDR2 having the amino acid sequence of SEQ ID NO: 76, and a CDR3 having the amino acid sequence of SEQ ID NO: 77; (b) a second polypeptide comprising an antigen-binding domain that binds a protein associated with a TCR complex; and (c) a third polypeptide comprising a TCR co-receptor cytosolic domain and transmembrane domain: wherein, the first polypeptide, the second polypeptide, and the third polypeptide are fused directly to each other, or joined by at least one linker. In some embodiments, the GUCY2C-binding domain comprises a CDR1 having the amino acid sequence of SEQ ID NO: 72, a CDR2 having the amino acid sequence of SEQ ID NO: 73, and a CDR3 having the amino acid sequence of SEQ ID NO: 74. In some embodiments, the GUCY2C-binding domain is a nanobody. In some embodiments, the GUCY2C-binding domain comprises an amino acid sequence at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to an amino acid sequence selected from the group consisting of SEQ ID NOs: 53-62. In some embodiments, the GUCY2C-binding domain comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 53-62. In some embodiments, the GUCY2C-binding domain comprises a CDR1 having the amino acid sequence of SEQ ID NO: 75, a CDR2 having the amino acid sequence of SEQ ID NO: 76, and a CDR3 having the amino acid sequence of SEQ ID NO: 77. In some embodiments, the GUCY2C-binding domain is a nanobody. In some embodiments, the GUCY2C-binding domain comprises an amino acid sequence at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to an amino acid sequence selected from the group consisting of SEQ ID NOs: 63-71. In some embodiments, the GUCY2C-binding domain comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 63-71.
[0004] In some embodiments, the first polypeptide, the second polypeptide, and the third polypeptide are in order from N-terminus to C-terminus. In some embodiments, the protein associated with the TCR complex is a CD3 protein. In some embodiments, the CD3 protein is a CD3γ protein, CD3δ protein and/or CD3ε protein. In some embodiments, the CD3 protein is a CD3ε protein. In some embodiments, the CD3 protein is a CD3ε protein.
[0005] In some embodiments, the antigen-binding domain that binds the protein associated with the TCR complex is derived from an antibody selected from UCHT1 OKT3, F6A, and L2K. In some embodiments, the antigen-binding domain that binds the protein associated with the TCR complex is a UCHT1 antigen-binding domain. In some embodiments, the UCHT1 antigen-binding domain is an scFv of UCHT1. In some embodiments, the UCHT1 antigen-binding domain comprises a Y to T mutation at a position corresponding to amino acid 182 of SEQ ID NO: 32 (Y182T). In some embodiments, the UCHT1 antigen-binding domain comprises a humanized variant of UCHT1 (huUCHT1). In some embodiments, the UCHT1 antigen-binding domain comprises a humanized variant of UCHT1 comprising a Y to T mutation at a position corresponding to amino acid 177 of SEQ ID NO: 40 (huUCHT1 (Y177T)). In some embodiments, the antigen-binding domain that binds the protein associated with the TCR complex comprises an amino acid sequence having at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence identity with SEQ ID NO: 32 (UCHT1), SEQ ID NO: 44 (UCHT1 (Y182T)), SEQ ID NO: 40 (huUCHT1), or SEQ ID NO: 42 (huUCHT1 (Y177T)).
[0006] In some embodiments, the CDR sequences of the antigen-binding domain that binds the protein associated with the TCR complex have 100% identity with the CDR sequences of the amino acid sequence of SEQ ID NO: 32 (UCHT1), SEQ ID NO: 44 (UCHT1 (Y182T)), SEQ ID NO: 40 (huUCHT1), or SEQ ID NO: 42 (huUCHT1 (Y177T)). In some embodiments, the CDR sequences of the antigen-binding domain that binds the protein associated with the TCR complex have 100% identity with the CDR sequences of the amino acid sequence of SEQ ID NO: 32 (UCHT1), SEQ ID NO: 44 (UCHT1 (Y182T)), SEQ ID NO: 40 (huUCHT1), or SEQ ID NO: 42 (huUCHT1 (Y177T)), and the non-CDR sequences of the antigen-binding domain that binds the protein associated with the TCR complex have at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the non-CDR sequences of the amino acid sequence of SEQ ID NO: 32 (UCHT1), SEQ ID NO: 44 (UCHT1 (Y182T)), SEQ ID NO: 40 (huUCHT1), or SEQ ID NO: 42 (huUCHT1 (Y177T)).
[0007] In some embodiments, the antigen-binding domain that binds the protein associated with the TCR complex is an OKT3 antigen-binding domain. In some embodiments, the antigen-binding domain that binds the protein associated with the TCR complex comprises an amino acid sequence having at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence identity with SEQ ID NO: 34 (OKT3). In some embodiments, the CDR sequences of the antigen-binding domain that binds the protein associated with the TCR complex have 100% identity with the CDR sequences of the amino acid sequence of SEQ ID NO: 34 (OKT3). In some embodiments, the CDR sequences of the antigen-binding domain that binds the protein associated with the TCR complex have 100% identity with the CDR sequences of the amino acid sequence of SEQ ID NO: 34 (OKT3), and the non-CDR sequences of the antigen-binding domain that binds the protein associated with the TCR complex have at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the non-CDR sequences of the amino acid sequence of SEQ ID NO: 34 (OKT3). In some embodiments, the antigen-binding domain that binds the protein associated with the TCR complex is a F6A antigen-binding domain. In some embodiments, the antigen-binding domain that binds the protein associated with the TCR complex comprises an amino acid sequence having at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence identity with SEQ ID NO: 36 (F6A). In some embodiments, the CDR sequences of the antigen-binding domain that binds the protein associated with the TCR complex have 100% identity with the CDR sequences of the amino acid sequence of SEQ ID NO: 36 (F6A). In some embodiments, the CDR sequences of the antigen-binding domain that binds the protein associated with the TCR complex have 100% identity with the CDR sequences of the amino acid sequence of SEQ ID NO: 36 (F6A), and the non-CDR sequences of the antigen-binding domain that binds the protein associated with the TCR complex have at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the non-CDR sequences of the amino acid sequence of SEQ ID NO: 36 (F6A). In some embodiments, the antigen-binding domain that binds the protein associated with the TCR complex is a L2K antigen-binding domain. In some embodiments, the antigen-binding domain that binds the protein associated with the TCR complex comprises an amino acid sequence having at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence identity with SEQ ID NO: 38 (L2K). In some embodiments, the CDR sequences of the antigen-binding domain that binds the protein associated with the TCR complex have 100% identity with the CDR sequences of the amino acid sequence of SEQ ID NO: 38 (L2K). In some embodiments, the CDR sequences of the antigen-binding domain that binds the protein associated with the TCR complex have 100% identity with the CDR sequences of the amino acid sequence of SEQ ID NO: 38 (L2K), and the non-CDR sequences of the antigen-binding domain that binds the protein associated with the TCR complex have at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the non-CDR sequences of the amino acid sequence of SEQ ID NO: 38 (L2K).
[0008] In some embodiments, the transmembrane domain is a CD4 transmembrane domain and the cytosolic domain is a CD4 cytosolic domain. In some embodiments, the transmembrane and cytosolic domain comprise an amino acid sequence having at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence identity with the amino acid sequence of SEQ ID NO: 46 (CD4 transmembrane and cytosolic domain). In some embodiments, the transmembrane domain is a CD8 transmembrane domain and the cytosolic domain is a CD8 cytosolic domain. In some embodiments, the component encoded by (a) and the component encoded by (c) are fused to the component encoded by (b). In some embodiments, the component encoded by (b) and the component encoded by (c) are fused to the component encoded by (a). In some embodiments, at least one linker joins the component encoded by (a) to the component encoded by (b). In some embodiments, the at least one linker is a glycine and/or serine-rich linker, a large protein domain, a long helix structure, or a short helix structure. In some embodiments, the at least one linker comprises an amino acid sequence having at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence identity with the amino acid sequence of SEQ ID NO: 26 ((G4S)4-based linker), SEQ ID NO: 28 (G4S-based linker), SEQ ID NO: 14 (CD4 based linker), SEQ ID NO: 12 (short helix connector), SEQ ID NO: 14 (long helix connector), SEQ ID NO: 16 (large domain connector), or SEQ ID NO: 24 ((G4S)3 flexible linker). In some embodiments, the GUCY2C-TAC protein does not comprise a co-stimulatory domain. In some embodiments, n the GUCY2C-TAC protein does not comprise an activation domain. In some embodiments, the GUCY2C-TAC protein further comprises a leader sequence. In some embodiments, the leader sequence comprises an amino acid sequence having at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence identity with the amino acid sequence of SEQ ID NO: 2 (muIgG leader), SEQ ID NO: 18 (huIgG leader), SEQ ID NO: 20 (huCD8a-1 leader) or SEQ ID NO: 30 (huCD8a-2 leader).
[0009] Disclosed herein, in certain embodiments, is a GUCY2C TAC protein comprising an amino acid sequence having at least 80% sequence identity with the amino acid sequence of any one of SEQ ID NOs: 79, 81, 83, 85, 87, 89, 91, 93, 95, 97, 99, 101, 103, 105, 107, 109, 111, 113, 115, 117, 119, 121, 123, 125, 127, 129, 131, 133, 135, 137, 139, 141, 143, 145, 147, 149, 151, and 153.
[0010] Disclosed herein, in certain embodiments, is a GUCY2C TAC protein comprising an amino acid sequence according to the amino acid sequence of any one of SEQ ID NOs: 79, 81, 83, 85, 87, 89, 91, 93, 95, 97, 99, 101, 103, 105, 107, 109, 111, 113, 115, 117, 119, 121, 123, 125, 127, 129, 131, 133, 135, 137, 139, 141, 143, 145, 147, 149, 151, and 153.
[0011] Disclosed herein, in certain embodiments, is a GUCY2C TAC protein comprising an amino acid sequence having at least 80% sequence identity with the amino acid sequence of SEQ ID NO: 131.
[0012] Disclosed herein, in certain embodiments, is a GUCY2C TAC protein comprising an amino acid sequence according to the amino acid sequence of SEQ ID NO: 131.
[0013] Disclosed herein, in certain embodiments, is a nucleic acid sequence encoding the GUCY2C TAC protein disclosed herein. In some embodiments, the nucleic acid comprises a sequence having at least 80% sequence identity with the nucleic acid sequence of any one of SEQ ID NOs: 78, 80, 82, 84, 86, 88, 90, 92, 94, 96, 98, 100, 102, 104, 106, 108, 110, 112, 114, 116, 118, 120, 122, 124, 126, 128, 130, 132, 134, 136, 138, 140, 142, 144, 146, 148, 150, and 152. In some embodiments, the nucleic acid sequence comprises the nucleic acid sequence of any one of SEQ ID NOs: 78, 80, 82, 84, 86, 88, 90, 92, 94, 96, 98, 100, 102, 104, 106, 108, 110, 112, 114, 116, 118, 120, 122, 124, 126, 128, 130, 132, 134, 136, 138, 140, 142, 144, 146, 148, 150, and 152.
[0014] Disclosed herein, in certain embodiments, is a T cell expressing the GUCY2C-TAC protein disclosed herein.
[0015] Disclosed herein, in certain embodiments, is a T cell comprising the nucleic acid sequence disclosed herein.
[0016] Disclosed herein, in certain embodiments, is a pharmaceutical composition comprising the T cell disclosed herein, and a pharmaceutically acceptable excipient.
[0017] Disclosed herein, in certain embodiments, is a method of treating a GUCY2C-expressing cancer in an individual in need thereof, comprising administering to the individual the pharmaceutical composition disclosed herein. In some embodiments, the cancer is a solid cancer. In some embodiments, the cancer is a colorectal cancer, a gastric cancer, a gastroesophageal junction cancer, an esophageal cancer, or a pancreatic cancer. In some embodiments, the cancer is a primary colorectal cancer, a primary gastric cancer, a primary gastroesophageal junction cancer, a primary esophageal cancer, or a primary pancreatic cancer. In some embodiments, the cancer is a metastatic colorectal cancer, a metastatic gastric cancer, a metastatic gastroesophageal junction cancer, a metastatic esophageal cancer, or a metastatic pancreatic cancer.
BRIEF DESCRIPTION OF THE DRAWINGS
[0018] FIGS. 1A-1B show the phenotype of GUCY2C-TAC T cells as determined by flow cytometry. FIG. 1A depicts representative flow plots of T cells dual-stained for transduction marker (mStraw) versus TAC expression (anti-myc). FIG. 1B depicts a bar graph showing the median fluorescence intensity (MFI) of TAC positive T cells.
[0019] FIG. 2 depicts the quantitative analysis of tumor cell growth as a function of GFP area at different E:T ratios for tumor cells grown in the presence of GUCY2C-TAC T cells.
[0020] FIG. 3 depicts a bar graph showing the proliferative potential, defined as the normalized division index, of GUCY2C-TAC T cells grown in the presence of GUCY2C-expressing leukemic cells and gastric cancer cells.
[0021] FIGS. 4A-4C depict the effect of 9 alternating rounds of GUCY2C-TAC T cell co-culture with target tumor cells, where co-culture occurs over a period of 3-to-4 days in each round. FIG. 4A depicts the quantitative analysis of GUCY2C-TAC T cell cytotoxicity against tumor cells over 9 alternating rounds of co-culture, with cytotoxicity evaluated as a function of GFP fluorescence and quantified by calculating the area under each GFP curve. FIG. 4B depicts the total amount of T cells retrieved after each round of co-culture was graphed relative to the initial total cells seeded at the start of each round. FIG. 4C depicts the phenotype of GUCY2C-TAC T cells at Day 0 and retrieved after rounds 1, 5 and 9, as determined by the percentage of total CD8+ T cells (top left panel), CD4+ T cells (top right panel), mStrawberry+ T cells (middle left panel), mStrawberry− T cells (middle right panel), CD8-gated T cells expressing CD69 (bottom left panel), CD8-gated then CD39-gated T cells expressing PD-1 and LAG3 (bottom right panel).
[0022] FIGS. 5A-5B depict the efficacy of GUCY2C-TAC T cells in mice inoculated with a liquid tumor model expressing GUCY2C. FIG. 5A depicts the total tumor burden in mice, as measured by bioluminescent signal over the course of the experiment, after no treatment (NT), administration of non-transduced T cells (NTD), or treatment with GUCY2C-TAC T cells. FIG. 5B depicts survival curves showing the percentage of survival over the course of the experiment.
[0023] FIG. 6 depicts the efficacy of GUCY2C-TAC T cells in mice inoculated with a solid tumor model expressing GUCY2C. Total tumor volume in mice, as determined by weekly caliper measurements over the course of the experiment, was monitored for animals having received no treatment (NT), administration of non-transduced T cells (NTD), or treatment with GUCY2C-TAC T cells.
[0024] FIGS. 7A-7B show the binding specificity of the G22H8 nanobody. FIG. 7A depicts binding of G22H8-GFP to target HEK or QT6 cells engineered with either GUCY2C-expressing plasmid, Protein A-expressing plasmid control, or empty vector control, as measured by mean fluorescence (y-axis), versus the concentration of fusion protein (x-axis). FIG. 7B depicts a membrane proteome array showing G22H8-GFP target binding (y-axis) versus human membrane proteins (x-axis).
[0025] FIG. 8 shows the expression level of GUCY2C in cancer cells naturally and ectopically expressing GUCY2C, as determined by flow cytometry.
[0026] FIG. 9 shows the expression level of GUCY2C in cancer cells naturally and ectopically expressing GUCY2C, as determined by mRNA analysis using droplet digital polymerase chain reaction (ddPCR).
[0027] FIG. 10 shows representative flow plots depicting dual-staining for transduction marker (mStrawberrv) versus CD69 early activation marker in GUCY2C-TAC T cells co-cultured with antigen-positive (HCT116-GUCY2C) or antigen-negative (HCT116) target cells.
[0028] FIG. 11 depicts a bar graph showing the normalized level of CD69 early activation marker expressed in GUCY2C-TAC T cells co-cultured with antigen-positive or antigen negative target cells, as determined by flow cytometry.
[0029] FIG. 12 shows representative flow plots depicting dual-staining for interferon gamma (IFNγ) versus tumor necrosis factor alpha (TNFα) in GUCY2C-TAC T cells permeabilized after co-culture with antigen-positive (HCT116GUCY2C or N87GUCY2C) or antigen-negative (HCT116 or N87) target cells.
[0030] FIG. 13 depicts bar graphs showing the normalized level of IL2, IFNγ, and TNFα cytokines produced in GUCY2C-TAC T cells after co-culture with antigen-positive or antigen negative target cells, as determined by flow cytometry.
[0031] FIG. 14 depicts a bar graph showing the percentage of target cells killed after co-culture with GUCY2C-TAC T cells.
DETAILED DESCRIPTION
[0032] Cancer is a major health challenge. According to the American Cancer Society, more than one million people in the United States are diagnosed with cancer each year. While patients with early stage disease are sometimes treated effectively by conventional therapies (surgery, radiation, chemotherapy), few options are available to patients with advanced disease, and those options are typically palliative in nature.
[0033] Active immunotherapy seeks to employ the patient's immune system to clear tumors and offers an option to patients who have failed conventional therapies. Generally, this treatment involves infusing patients with large numbers of tumor-specific T cells. To this point, most engineered T cell therapies involving genetic modification of the T cells yield: (i) forced expression of T cell receptor (TCR): or (ii) a chimeric antigen receptor (CAR) specific for antigen targets on the tumor. To date, the chimeric antigen receptors used for engineering T cells consist of: (i) a targeting domain, usually a single-chain fragment variable (scFv); (ii) a transmembrane domain; and (iii) a cytosolic domain that contains signaling elements from the T cell receptor and associated proteins. Such chimeric antigen receptors have also been referred to as “T-body” or “Chimeric Immune Receptor” (CIR), but currently, most researchers use the term “CAR”. One advantage of the CAR approach is that it allows any patient's immune cells to be targeted against any desirable target in a major histocompatibility complex (MHC) independent manner. This is appealing as MHC presentation is often defective in tumor cells.
[0034] CARs are considered in modular terms and scientists have spent considerable time investigating the influence of different cytoplasmic signaling domains on CAR function. Conventional CARs generally share two main components: (i) the CD3 zeta cytoplasmic domain, which contains immunotyrosine activation motifs (ITAMs) critical for T cell activation; and (ii) components of costimulatory receptors that trigger important survival pathways such as the Akt pathway.
[0035] The first-generation CARs employed a single signaling domain from either CD3ζ or FcεRIγ. Second-generation CARs combined the signaling domain of CD3ζ with the cytoplasmic domain of costimulatory receptors from either the CD28 or TNFR family of receptors. Most CAR-engineered T cells that are currently being tested in the clinic employ second-generation CARs where CD3ζ is coupled to the cytoplasmic domain of either CD28 or CD137. These second generation CARs have demonstrated anti-tumor activity in CD19-positive tumors. Third-generation CARs combined multiple costimulatory domains, but there is concern that third-generation CARs may lose antigen-specificity.
[0036] While CAR-engineered T cells have shown considerable promise in clinical application, they rely on a synthetic method for replacing the native activation signal that is provided by the T cell receptor (TCR). Since this synthetic receptor does not deliver all of the signaling components associated with the TCR (ex. ITAMs on CD3γ, CD3δ, CD3ε), it remains unclear whether the T cells are optimally activated by the CAR or how the CAR activation affects T cell differentiation (ex. progression to memory). Furthermore, since the CAR signaling domains are disconnected from their natural regulatory partners by the very nature of the CAR structure, there is an inherent risk that CARs may lead to a low-level of constitutive activation, which could result in off-target toxicities. Therefore, the synthetic nature of the prototypic CAR may disrupt canonical mechanisms that limit TCR activation, and may underpin the severe toxicity often associated with therapeutic doses of conventional CAR T cells.
[0037] Given these limitations, it is preferable to re-direct T cells to attack tumors via their natural TCR. An alternate chimeric receptor, termed a T cell Antigen Coupler (TAC or TAC) receptor, has been developed which employs a distinct biology to direct the T cell to attack tumors. While the CAR is a fully synthetic receptor that stitches together components of T cell receptor (TCR) signaling complex, the TAC receptor re-directs the TCR towards tumor targets and recapitulates the native TCR signaling structure. For example, in some embodiments, the TACs disclosed herein activate natural Major Histocompatibility complex (MHC) signaling through the T cell receptor (TCR), while retaining MHC-unrestricted targeting. Further, the TACs disclosed herein recruit the T Cell Receptor (TCR) in combination with co-receptor stimulation. Moreover, in some embodiments, TACs disclosed herein show enhanced activity and safety.
Certain Terminology
[0038] The term “antigen-binding domain,” refers to any substance or molecule that binds, directly or indirectly, to a target (e.g., GUCY2C). Antigen-binding domains include antibodies or fragments thereof, peptides, peptidomimetics, proteins, glycoproteins, proteoglycans, carbohydrates, lipids, nucleic acids, or small molecules that bind to a target.
[0039] As used herein, unless otherwise indicated, the term “antibody” is understood to mean an intact antibody (e.g., an intact monoclonal antibody), or a fragment thereof, such as a Fc fragment of an antibody (e.g., an Fc fragment of a monoclonal antibody), or an antigen-binding fragment of an antibody (e.g., an antigen-binding fragment of a monoclonal antibody), including an intact antibody, antigen-binding fragment, or Fc fragment that has been modified, engineered, or chemically conjugated. In general, antibodies are multimeric proteins that contain four polypeptide chains. Two of the polypeptide chains are called immunoglobulin heavy chains (H chains), and two of the polypeptide chains are called immunoglobulin light chains (L chains). The immunoglobulin heavy and light chains are connected by an interchain disulfide bond. The immunoglobulin heavy chains are connected by interchain disulfide bonds. A light chain consists of one variable region (VL) and one constant region (CL). The heavy chain consists of one variable region (VH) and at least three constant regions (CH1, CH2 and CH3). The variable regions determine the binding specificity of the antibody. Each variable region contains three hypervariable regions known as complementarity determining regions (CDRs) flanked by four relatively conserved regions known as framework regions (FRs). The extent of the FRs and CDRs has been defined (Kabat, E. A., et al. (1991) SEQUENCES OF PROTEINS OF IMMUNOLOGICAL INTEREST , FIFTH EDITION , U.S. Department of Health and Human Services, NIH Publication No. 91-3242; and Chothia, C. et al. (1987) J. MOL. BIOL. 196:901-917). CDRs can also be identified by alignment of the amino acid sequences. FRs contain conserved amino acid sequences, thus CDR sequences can be identified by identification of non-conserved amino acid residues between variable regions with conserved FRs. The three CDRs, referred to as CDR1, CDR2, and CDR3, contribute to the antibody binding specificity. Naturally occurring antibodies have been used as starting material for engineered antibodies, such as chimeric antibodies and humanized antibodies. Examples of antibody-based antigen-binding fragments include Fab, Fab′, (Fab′)2, Fv, single chain antibodies (e.g., scFv), minibodies, and diabodies. Examples of antibodies that have been modified or engineered include chimeric antibodies, humanized antibodies, and multispecific antibodies (e.g., bispecific antibodies). An example of a chemically conjugated antibody is an antibody conjugated to a toxin moiety.
[0040] The term “T cell” as used herein refers to a type of lymphocyte that plays a central role in cell-mediated immunity. T cells, also referred to as T lymphocytes, are distinguished from other lymphocytes, such as B cells and natural killer cells, by the presence of a T-cell receptor (TCR) on the cell surface. There are several subsets of T cells with distinct functions, including but not limited to, T helper cells, cytotoxic T cells, memory T cells, regulatory T cells and natural killer T cells.
[0041] The term “γδ T cell” or “gamma delta T cell” or “gd T cell” as used herein refers to any lymphocyte having a γδ T cell receptor (TCR) on its surface, including one γ-chain and one δ-chain.
[0042] The term “T cell antigen coupler” or TAC is used interchangeably with “trifunctional T cell antigen coupler” or Tri-TAC and refers to an engineered nucleic acid construct or polypeptide comprising (a) an antigen-binding domain that binds a target, (b) an antigen-binding domain that binds a protein associated with a T cell receptor (TCR) complex, and (c) a T cell receptor signaling domain.
[0043] The term “polynucleotide” and/or “nucleic acid sequence” and/or “nucleic acid” as used herein refers to a sequence of nucleoside or nucleotide monomers consisting of bases, sugars and intersugar (backbone) linkages. The term also includes modified or substituted sequences comprising non-naturally occurring monomers or portions thereof. The nucleic acid sequences of the present application may be deoxyribonucleic acid sequences (DNA) or ribonucleic acid sequences (RNA) and may include naturally occurring bases including adenine, guanine, cytosine, thymidine and uracil. The sequences may also contain modified bases. Examples of such modified bases include aza and deaza adenine, guanine, cytosine, thymidine and uracil; and xanthine and hypoxanthine. The nucleic acids of the present disclosure may be isolated from biological organisms, formed by laboratory methods of genetic recombination or obtained by chemical synthesis or other known protocols for creating nucleic acids.
[0044] The term “isolated polynucleotide” or “isolated nucleic acid sequence” as used herein refers to a nucleic acid substantially free of cellular material or culture medium when produced by recombinant DNA techniques, or chemical precursors, or other chemicals when chemically synthesized. An isolated nucleic acid is also substantially free of sequences which naturally flank the nucleic acid (i.e., sequences located at the 5′ and 3′ ends of the nucleic acid) from which the nucleic acid is derived. The term “nucleic acid” is intended to include DNA and RNA and is either double stranded or single stranded, and represents the sense or antisense strand. Further, the term “nucleic acid” includes the complementary nucleic acid sequences.
[0045] The term “recombinant nucleic acid” or “engineered nucleic acid” as used herein refers to a nucleic acid or polynucleotide that is not naturally occurring (e.g., naturally found in a biological organism). For example, recombinant nucleic acids may be formed by laboratory methods of genetic recombination (such as molecular cloning) to create sequences that would not otherwise be found in nature. Recombinant nucleic acids may also be created by chemical synthesis or other known protocols for creating nucleic acids.
[0046] The terms “peptide”, “polypeptide,” and “protein” as used herein mean a chain of amino acids. The term protein as used herein further means a large molecule comprising one or more chains of amino acids and, in some embodiments, is a fragment or domain of a protein or a full length protein. Furthermore, as used herein, the term protein either refers to a linear chain of amino acids or to a chain of amino acids that has been processed and folded into a functional protein. The protein structure is divided into four distinct levels: (1) primary structure—referring to the sequence of amino acids in the polypeptide chain. (2) secondary structure—referring to the regular local sub-structures on the polypeptide backbone chain, such as α-helix and β-sheets, (3) tertiary structure—referring to the three-dimensional structure if monomeric and multimeric protein molecules, and (4) quaternary structure—referring to the three-dimensional structure comprising the aggregation of two or more individual polypeptide chains that operate as a single functional unit. The use of peptide or polypeptide herein does not mean that the chain of amino acids is not also a protein (i.e., a chain of amino acids having a secondary, tertiary or quatemary structure).
[0047] The term “isolated polypeptide” refers to a polypeptide substantially free of cellular material or culture medium when produced by recombinant DNA techniques, or chemical precursors or other chemicals when chemically synthesized.
[0048] The term “vector” as used herein refers to a polynucleotide that is used to deliver a nucleic acid to the inside of a cell. In some embodiments, a vector is an expression vector comprising expression control sequences (for example, a promoter) operatively linked to a nucleic acid to be expressed in a cell. Vectors known in the art include, but are not limited to, plasmids, phages, cosmids and viruses.
[0049] The term “tumor antigen” or “tumor associated antigen” as used herein refers to an antigenic substance produced in tumor cells that triggers an immune response in a host (e.g., which is presented by MHC complexes). In some embodiments, a tumor antigen is on the surface of a tumor cell.
[0050] As used herein, the term “transmembrane and cytosolic domain” refers to a polypeptide that comprises a transmembrane domain and a cytosolic domain of a protein associated with the T cell receptor (TCR) complex. In some embodiments, such transmembrane and cytosolic domain may include, but is not limited to, protein domains that (a) associate with the lipid raft and/or (b) bind Lck.
[0051] A “TCR co-receptor” as used herein, refers to a molecule that assists the T cell receptor (TCR) in communicating with an antigen-presenting cell. Examples of TCR co-receptors include but are not limited to, CD4, LAG3, and CD8.
[0052] A “TCR co-stimulator” or “co-stimulatory domain” as used herein, refers to a molecule that enhances the response of a T cell to an antigen and may be considered a signal that leads to the activation of the TCR. Examples of TCR co-stimulators include but are not limited to, ICOS, CD27, CD28, 4-1BB (CD 137), OX40 (CD134), CD30, CD40, lymphocyte fiction-associated antigen 1 (LFA-1), CD2. CD7, LIGHT, NKG2C, B7-H3, and a ligand that specifically binds CD83.
[0053] The terms “recipient”, “individual”, “subject”, “host”, and “patient”, are used interchangeably herein and in some embodiments, refer to any mammalian subject for whom diagnosis, treatment, or therapy is desired, particularly humans. “Mammal” for purposes of treatment refers to any animal classified as a mammal, including humans, domestic and farm animals, and laboratory, zoo, sports, or pet animals, such as dogs, horses, cats, cows, sheep, goats, pigs, mice, rats, rabbits, guinea pigs, monkeys etc. In some embodiments, the mammal is human. None of these terms require the supervision of medical personnel.
[0054] As used herein, the terms “treatment,” “treating,” and the like, in some embodiments, refer to administering an agent, or carrying out a procedure, for the purposes of obtaining an effect. The effect may be prophylactic in terms of completely or partially preventing a disease or symptom thereof and/or may be therapeutic in terms of affecting a partial or complete cure for a disease and/or symptoms of the disease. “Treatment,” as used herein, may include treatment of a disease or disorder (e.g., cancer) in a mammal, particularly in a human, and includes: (a) preventing the disease or a symptom of a disease from occurring in a subject which may be predisposed to the disease but has not yet been diagnosed as having it (e.g., including diseases that may be associated with or caused by a primary disease: (b) inhibiting the disease, i.e., arresting its development; and (c) relieving the disease, i.e., causing regression of the disease. Treating may refer to any indicia of success in the treatment or amelioration or prevention of a cancer, including any objective or subjective parameter such as abatement; remission; diminishing of symptoms; or making the disease condition more tolerable to the patient; slowing in the rate of degeneration or decline; or making the final point of degeneration less debilitating. The treatment or amelioration of symptoms is based on one or more objective or subjective parameters; including the results of an examination by a physician. Accordingly, the term “treating” includes the administration of the compounds or agents of the present invention to prevent, delay, alleviate, arrest or inhibit development of the symptoms or conditions associated with diseases (e.g., cancer). The term “therapeutic effect” refers to the reduction, elimination, or prevention of the disease, symptoms of the disease, or side effects of the disease in the subject.
[0055] As used herein, singular forms “a”, “and,” and “the” include plural referents unless the context clearly indicates otherwise. Thus, for example, reference to “an antibody” includes a plurality of antibodies and reference to “an antibody” in some embodiments includes multiple antibodies, and so forth.
[0056] As used herein, all numerical values or numerical ranges include whole integers within or encompassing such ranges and fractions of the values or the integers within or encompassing ranges unless the context clearly indicates otherwise. Thus, for example, reference to a range of 90-100%, includes 91%, 92%, 93%, 94%, 95%, 95%, 96%, 97%, etc., as well as 91.1%, 91.2%, 91.3%, 91.4%, 91.5%, etc., 92.1%, 92.2%, 92.3%, 92.4%, 92.5%, etc., and so forth. In another example, reference to a range of 1-5,000 fold includes 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, fold, etc., as well as 1.1, 1.2, 1.3, 1.4, 1.5, fold, etc., 2.1, 2.2, 2.3, 2.4, 2.5, fold, etc., and so forth.
[0057] “About” a number, as used herein, refers to range including the number and ranging from 10% below that number to 10% above that number. “About” a range refers to 10% below the lower limit of the range, spanning to 10% above the upper limit of the range.
[0058] “Percent (%) identity” refers to the extent to which two sequences (nucleotide or amino acid) have the same residue at the same positions in an alignment. For example, “an amino acid sequence is X % identical to SEQ ID NO: Y” refers to % identity of the amino acid sequence to SEQ ID NO: Y and is elaborated as X % of residues in the amino acid sequence are identical to the residues of sequence disclosed in SEQ ID NO: Y. Generally, computer programs are employed for such calculations. Exemplary programs that compare and align pairs of sequences, include ALIGN (Myers and Miller, 1988), FASTA (Pearson and Lipman, 1988; Pearson, 1990) and gapped BLAST (Altschul et al., 1997), BLASTP. BLASTN, or GCG (Devereux et al., 1984).
[0059] As used herein, the term “selective binding” refers to the higher affinity with which a molecule (e.g., protein such as an antigen-binding domain of TAC) binds its target molecule (e.g., target antigen such as GUCY2C) over other molecules. Unless indicated otherwise, the terms “selective binding” and “specific binding” are used interchangeably herein.
[0060] As used herein, the term GUCY2C means the enzyme Guanylate Cyclase 2C. GUCY2C is a transmembrane protein that functions as a receptor for endogenous peptides guanylin and uroguanylin, and the heat-stable E. coli enterotoxin. The encoded protein activates the cystic fibrosis transmembrane conductance regulator. GUCY2C produces the cGMP following activation by the binding of guanylin or uroguanylin, regulating intestinal homeostasis, tumorigenesis, and obesity. Cell surface expression of GUCY2C is found on luminal surfaces of the intestinal epithelium and certain hypothalamic neurons. Over-expression of GUCY2C is found in tumors that evolve from intestinal metaplasia, including colorectal, esophageal, gastric, and pancreatic cancers. Over-expression is maintained in >95% of colorectal cancer metastases.
T Cell Antigen Couplers (TACs)
[0061] Disclosed herein, in certain embodiments, are nucleic acids encoding GUCY2C T cell-antigen coupler (TAC) polypeptides. In some embodiments, the nucleic acids encoding the GUCY2C TAC comprise: (a) a first polynucleotide encoding an antigen-binding domain that binds GUCY2C; (b) a second polynucleotide encoding an antigen-binding domain that binds the TCR complex; and (c) a third polynucleotide encoding a transmembrane domain and cytosolic domain. In some embodiments, the nucleic acids comprise, in order (e.g., from 5′ to 3′): (a) the first polynucleotide; (b) the second polynucleotide; and (c) the third polynucleotide encoding a TCR co-receptor cytosolic domain and transmembrane domain. In some embodiments, the nucleic acids encoding the GUCY2C TAC do not encode a co-stimulatory domain. In some embodiments, the nucleic acids encoding the GUCY2C TAC do not encode a co-activation domain.
[0062] Further disclosed herein, in certain embodiments, are GUCY2C T cell-antigen coupler (TAC) polypeptides. In some embodiments, the GUCY2C TAC polypeptides comprise: (a) an antigen-binding domain that binds GUCY2C; (b) an antigen-binding domain that binds the TCR complex; and (c) a transmembrane domain and cytosolic domain. In some embodiments, the GUCY2C TAC polypeptides comprise, in order (e.g., from N-terminus to C-terminus) (a) the antigen-binding domain that binds GUCY2C; (b) the antigen-binding domain that binds the TCR complex; and (c) the transmembrane domain and cytosolic domain. In some embodiments, the GUCY2C TAC polypeptides do not include a co-stimulatory domain. In some embodiments, the GUCY2C TAC polypeptides do not include a co-activation domain.
[0063] Further disclosed herein, in certain embodiments, are expression vectors comprising a nucleic acid encoding a GUCY2C TAC polypeptide as described herein.
[0064] Further disclosed herein, in certain embodiments, are T cells comprising a nucleic acid encoding a GUCY2C TAC polypeptide as described herein, T cells comprising an expression vector encoding a GUCY2C TAC polypeptide as described herein, or T cells comprising a GUCY2C TAC polypeptide as described herein.
[0065] Further disclosed herein, in certain embodiments, are methods of treating a cancer in an individual in need thereof, comprising administering to the individual a T cell comprising a GUCY2C T cell-antigen coupler (TAC) polypeptide as described herein.
TCR Complex Protein Antigen-Binding Domain
[0066] In certain embodiments, the GUCY2C TAC comprises an antigen-binding domain that binds a protein associated with the TCR complex. A “TCR complex protein antigen-binding domain,” also referred to as a “TCR complex antigen-binding domain,” “antigen-binding domain that binds the TCR complex,” or “antigen-binding domain that binds a protein associated with the TCR complex,” refers to any substance or molecule that binds, directly or indirectly, toa protein associated with a TCR complex. In some embodiments, the antigen-binding domain that binds a protein associated with a TCR complex selectively binds to a protein of the TCR. In some embodiments, the antigen-binding domain that binds a protein associated with a TCR complex comprises a substance that specifically binds to a protein of the TCR.
[0067] In some embodiments, the TCR complex protein antigen-binding domain is selected from antibodies or fragments thereof, for example, single chain antibodies (e.g., single-chain fragment variable antibodies (scFvs)), single domain antibodies (e.g., heavy-chain-only antibodies (VHH), shark heavy-chain-only antibodies (VNAR)), nanobodies, diabodies, minibodies, Fab fragments, Fab′ fragments, F(ab′)2 fragments, or Fv fragments that bind to a protein of the TCR. In some embodiments, the TCR complex protein antigen-binding domain is selected from ankyrin repeat proteins (DARPins), affibodies, adnectins, affilins, phylomers; fynomers, affimers, peptide aptamers, lectins, knottins, centyrins, anticalins, peptides, peptidomimetics, proteins, glycoproteins, or proteoglycans that bind to a protein of the TCR, or naturally occurring ligands for a protein of the TCR. In some embodiments, the TCR complex protein antigen-binding domain is a non-protein compound that binds to a protein of the TCR, including but not limited to carbohydrates, lipids, nucleic acids, or small molecules. In some embodiments, the TCR complex protein antigen-binding domain is a designed ankyrin repeat (DARPin) targeted to a protein of the TCR. In some embodiments, the TCR complex protein antigen-binding domain is a single-chain variable fragment (scFv) targeted to a protein of the TCR. In some embodiments, the TCR complex protein antigen-binding domain is a nanobody targeted to a protein of the TCR.
[0068] Proteins associated with the TCR include, but are not limited, to the TCR alpha (α) chain, TCR beta (β) chain, TCR gamma (γ) chain, TCR delta (δ) chain, CD3γ chain, CD3δ chain and CD3ε chains. In some embodiments, an antigen-binding domain that binds a protein associated with the TCR complex is an antibody to the TCR alpha (α) chain, TCR beta (β) chain, TCR gamma (γ) chain, TCR delta (δ) chain, CD3γ chain, CD3δ chain and/or CD3ε chain. In some embodiments, the protein associated with a TCR complex is CD3. In some embodiments, the protein associated with a TCR complex is CD3ε. In some embodiments, the antigen-binding domain that binds CD3 is an antibody, for example, a single chain antibody, for example a single-chain variable fragment (scFv). Examples of CD3 antibodies, include, but are not limited to, UCHT1, OKT3, F6A, L2K, muromonab, otelixizumab, teplizumab, visilizumab, CD3-12, MEM-57, 4D10A6, CD3D, or TR66.
[0069] In some embodiments, the antigen-binding domain that binds the TCR complex is UCHT1, or a variant thereof. In some embodiments, the UCHT1 antigen-binding domain is encoded by SEQ ID NO: 31. In some embodiments, the UCHT1 antigen-binding domain comprises SEQ ID NO: 32. In some embodiments, the UCHT1 antigen-binding domain is mutated. In some embodiments, the UCHT1 antigen-binding domain comprises a Y to T mutation at a position corresponding to amino acid 182 of SEQ ID NO: 32 (Y182T). In some embodiments, the UCHT1 (Y182T) antigen-binding domain is encoded by SEQ ID NO: 43. In some embodiments, the UCHT1 (Y182T) antigen-binding domain comprises SEQ ID NO: 44. In some embodiments, the antigen-binding domain that binds the TCR complex is a humanized UCHT1 (huUCHT1). In some embodiments, the huUCHT1 antigen-binding domain is encoded by SEQ ID NO: 39. In some embodiments, the huUCHT1 antigen-binding domain comprises SEQ ID NO: 40. In some embodiments, the huUCHT1 has a Y to T mutation at a position corresponding to amino acid 177 of SEQ ID NO: 40 (Y177T). In some embodiments, the huUCHT1 (Y177T) antigen-binding domain is encoded by SEQ ID NO: 41. In some embodiments, the huUCHT1 antigen-binding domain comprises SEQ ID NO: 42.
[0070] In some embodiments, the polynucleotide encoding the antigen-binding domain that binds the protein associated with the TCR complex comprises a nucleotide sequence having at least 70% sequence identity with the nucleotide sequence of SEQ ID NO: 31 (UCHT1). In some embodiments, the polynucleotide encoding the antigen-binding domain that binds the protein associated with the TCR complex comprises a nucleotide sequence having at least 75% sequence identity with the nucleotide sequence of SEQ ID NO: 31 (UCHT1). In some embodiments, the polynucleotide encoding the antigen-binding domain that binds the protein associated with the TCR complex comprises a nucleotide sequence having at least 80% sequence identity with the nucleotide sequence of SEQ ID NO: 31 (UCHT1). In some embodiments, the polynucleotide encoding the antigen-binding domain that binds the protein associated with the TCR complex comprises a nucleotide sequence having at least 85% sequence identity with the nucleotide sequence of SEQ ID NO: 31 (UCHT1). In some embodiments, the polynucleotide encoding the antigen-binding domain that binds the protein associated with the TCR complex comprises a nucleotide sequence having at least 90% sequence identity with the nucleotide sequence of SEQ ID NO: 31 (UCHT1). In some embodiments, the polynucleotide encoding the antigen-binding domain that binds the protein associated with the TCR complex comprises a nucleotide sequence having at least 95% sequence identity with the nucleotide sequence of SEQ ID NO: 31 (UCHT1). In some embodiments, the polynucleotide encoding the antigen-binding domain that binds the protein associated with the TCR complex comprises a nucleotide sequence having at least 96% sequence identity with the nucleotide sequence of SEQ ID NO: 31 (UCHT1). In some embodiments, the polynucleotide encoding the antigen-binding domain that binds the protein associated with the TCR complex comprises a nucleotide sequence having at least 97% sequence identity with the nucleotide sequence of SEQ ID NO: 31 (UCHT1). In some embodiments, the polynucleotide encoding the antigen-binding domain that binds the protein associated with the TCR complex comprises a nucleotide sequence having at least 98% sequence identity with the nucleotide sequence of SEQ ID NO: 31 (UCHT1). In some embodiments, the polynucleotide encoding the antigen-binding domain that binds the protein associated with the TCR complex comprises a nucleotide sequence having at least 99% sequence identity with the nucleotide sequence of SEQ ID NO: 31 (UCHT1). In some embodiments, the polynucleotide encoding the antigen-binding domain that binds the protein associated with the TCR complex comprises the nucleotide sequence of SEQ ID NO: 31 (UCHT1).
[0071] In some embodiments, the antigen-binding domain that binds the protein associated with the TCR complex comprises an amino acid sequence having at least 70% sequence identity with the amino acid sequence of SEQ ID NO: 32 (UCHT1). In some embodiments, the antigen-binding domain that binds the protein associated with the TCR complex comprises an amino acid sequence having at least 75% sequence identity with the amino acid sequence of SEQ ID NO: 32 (UCHT1). In some embodiments, the antigen-binding domain that binds the protein associated with the TCR complex comprises an amino acid sequence having at least 80% sequence identity with the amino acid sequence of SEQ ID NO: 32 (UCHT1). In some embodiments, the antigen-binding domain that binds the protein associated with the TCR complex comprises an amino acid sequence having at least 85% sequence identity with the amino acid sequence of SEQ ID NO: 32 (UCHT1). In some embodiments, the antigen-binding domain that binds the protein associated with the TCR complex comprises an amino acid sequence having at least 90% sequence identity with the amino acid sequence of SEQ ID NO: 32 (UCHT1). In some embodiments, the antigen-binding domain that binds the protein associated with the TCR complex comprises an amino acid sequence having at least 95% sequence identity with the amino acid sequence of SEQ ID NO: 32 (UCHT1). In some embodiments, the antigen-binding domain that binds the protein associated with the TCR complex comprises an amino acid sequence having at least 96% sequence identity with the amino acid sequence of SEQ ID NO: 32 (UCHT1). In some embodiments, the antigen-binding domain that binds the protein associated with the TCR complex comprises an amino acid sequence having at least 97% sequence identity with the amino acid sequence of SEQ ID NO: 32 (UCHT1). In some embodiments, the antigen-binding domain that binds the protein associated with the TCR complex comprises an amino acid sequence having at least 98% sequence identity with the amino acid sequence of SEQ ID NO: 32 (UCHT1). In some embodiments, the antigen-binding domain that binds the protein associated with the TCR complex comprises an amino acid sequence having at least 99% sequence identity with the amino acid sequence of SEQ ID NO: 32 (UCHT1). In some embodiments, the antigen-binding domain that binds the protein associated with the TCR complex comprises the amino acid sequence of SEQ ID NO: 32 (UCHT1). In some embodiments, the CDR sequences of the antigen-binding domain that binds the protein associated with the TCR complex have 100% identity with the CDR sequences of the amino acid sequence of SEQ ID NO: 32 (UCHT1) (i.e., the antigen-binding domain that binds the protein associated with the TCR complex comprises an amino acid sequence comprising a CDRH1, CDRH2, CDRH3, CDRL1, CDRL2, and CDRL3, each having 100% identity to the corresponding CDR in the amino acid sequence of SEQ ID NO: 32 (UCHT1). In some embodiments, the CDR sequences of the antigen-binding domain that binds the protein associated with the TCR complex have 100% identity with the CDR sequences of the amino acid sequence of SEQ ID NO: 32 (UCHT1), and the non-CDR (e.g., framework) sequences of the antigen-binding domain that binds the protein associated with the TCR complex have at least 80% sequence identity with the non-CDR (e.g., framework) sequences of the amino acid sequence of SEQ ID NO: 32 (UCHT1). In some embodiments, the CDR sequences of the antigen-binding domain that binds the protein associated with the TCR complex have 100% identity with the CDR sequences of the amino acid sequence of SEQ ID NO: 32 (UCHT1), and the non-CDR (e.g., framework) sequences of the antigen-binding domain that binds the protein associated with the TCR complex have at least 85% sequence identity with the non-CDR (e.g., framework) sequences of the amino acid sequence of SEQ ID NO: 32 (UCHT1). In some embodiments, the CDR sequences of the antigen-binding domain that binds the protein associated with the TCR complex have 100% identity with the CDR sequences of the amino acid sequence of SEQ ID NO: 32 (UCHT1), and the non-CDR (e.g., framework) sequences of the antigen-binding domain that binds the protein associated with the TCR complex have at least 90% sequence identity with the non-CDR (e.g., framework) sequences of the amino acid sequence of SEQ ID NO: 32 (UCHT1). In some embodiments, the CDR sequences of the antigen-binding domain that binds the protein associated with the TCR complex have 100% identity with the CDR sequences of the amino acid sequence of SEQ ID NO: 32 (UCHT1), and the non-CDR (e.g., framework) sequences of the antigen-binding domain that binds the protein associated with the TCR complex have at least 95% sequence identity with the non-CDR (e.g., framework) sequences of the amino acid sequence of SEQ ID NO: 32 (UCHT1). In some embodiments, the CDR sequences of the antigen-binding domain that binds the protein associated with the TCR complex have 100% identity with the CDR sequences of the amino acid sequence of SEQ ID NO: 32 (UCHT1), and the non-CDR (e.g., framework) sequences of the antigen-binding domain that binds the protein associated with the TCR complex have at least 96% sequence identity with the non-CDR (e.g., framework) sequences of the amino acid sequence of SEQ ID NO: 32 (UCHT1). In some embodiments, the CDR sequences of the antigen-binding domain that binds the protein associated with the TCR complex have 100% identity with the CDR sequences of the amino acid sequence of SEQ ID NO: 32 (UCHT1), and the non-CDR (e.g., framework) sequences of the antigen-binding domain that binds the protein associated with the TCR complex have at least 97% sequence identity with the non-CDR (e.g., framework) sequences of the amino acid sequence of SEQ ID NO: 32 (UCHT1). In some embodiments, the CDR sequences of the antigen-binding domain that binds the protein associated with the TCR complex have 100% identity with the CDR sequences of the amino acid sequence of SEQ ID NO: 32 (UCHT1), and the non-CDR (e.g., framework) sequences of the antigen-binding domain that binds the protein associated with the TCR complex have at least 98% sequence identity with the non-CDR (e.g., framework) sequences of the amino acid sequence of SEQ ID NO: 32 (UCHT1). In some embodiments, the CDR sequences of the antigen-binding domain that binds the protein associated with the TCR complex have 100% identity with the CDR sequences of the amino acid sequence of SEQ ID NO: 32 (UCHT1), and the non-CDR (e.g., framework) sequences of the antigen-binding domain that binds the protein associated with the TCR complex have at least 99% sequence identity with the non-CDR (e.g., framework) sequences of the amino acid sequence of SEQ ID NO: 32 (UCHT1).
[0072] In some embodiments, the polynucleotide encoding the antigen-binding domain that binds the protein associated with the TCR complex comprises a nucleotide sequence having at least 70% sequence identity with the nucleotide sequence of SEQ ID NO: 43 (UCHT1 (Y182T)). In some embodiments, the polynucleotide encoding the antigen-binding domain that binds the protein associated with the TCR complex comprises a nucleotide sequence having at least 75% sequence identity with the nucleotide sequence of SEQ ID NO: 43 (UCHT1 (Y182T)). In some embodiments, the polynucleotide encoding the antigen-binding domain that binds the protein associated with the TCR complex comprises a nucleotide sequence having at least 80% sequence identity with the nucleotide sequence of SEQ ID NO: 43 (UCHT1 (Y182T)). In some embodiments, the polynucleotide encoding the antigen-binding domain that binds the protein associated with the TCR complex comprises a nucleotide sequence having at least 85% sequence identity with the nucleotide sequence of SEQ ID NO: 43 (UCHT1 (Y182T)). In some embodiments, the polynucleotide encoding the antigen-binding domain that binds the protein associated with the TCR complex comprises a nucleotide sequence having at least 90% sequence identity with the nucleotide sequence of SEQ ID NO: 43 (UCHT1 (Y182T)). In some embodiments, the polynucleotide encoding the antigen-binding domain that binds the protein associated with the TCR complex comprises a nucleotide sequence having at least 95% sequence identity with the nucleotide sequence of SEQ ID NO: 43 (UCHT1 (Y182T)). In some embodiments, the polynucleotide encoding the antigen-binding domain that binds the protein associated with the TCR complex comprises a nucleotide sequence having at least 96% sequence identity with the nucleotide sequence of SEQ ID NO: 43 (UCHT1 (Y182T)). In some embodiments, the polynucleotide encoding the antigen-binding domain that binds the protein associated with the TCR complex comprises a nucleotide sequence having at least 97% sequence identity with the nucleotide sequence of SEQ ID NO: 43 (UCHT1 (Y182T)). In some embodiments, the polynucleotide encoding the antigen-binding domain that binds the protein associated with the TCR complex comprises a nucleotide sequence having at least 98% sequence identity with the nucleotide sequence of SEQ ID NO: 43 (UCHT1 (Y182T)). In some embodiments, the polynucleotide encoding the antigen-binding domain that binds the protein associated with the TCR complex comprises a nucleotide sequence having at least 99% sequence identity with the nucleotide sequence of SEQ ID NO: 43 (UCHT1 (Y182T)). In some embodiments, the polynucleotide encoding the antigen-binding domain that binds the protein associated with the TCR complex comprises the nucleotide sequence of SEQ ID NO: 43 (UCHT1 (Y82T)).
[0073] In some embodiments, the antigen-binding domain that binds the protein associated with the TCR complex comprises an amino acid sequence having at least 70% sequence identity with the amino acid sequence of SEQ ID NO: 44 (UCHT1 (Y182T)). In some embodiments, the antigen-binding domain that binds the protein associated with the TCR complex comprises an amino acid sequence having at least 75% sequence identity with the amino acid sequence of SEQ ID NO: 44 (UCHT1 (Y182T)). In some embodiments, the antigen-binding domain that binds the protein associated with the TCR complex comprises an amino acid sequence having at least 80% sequence identity with the amino acid sequence of SEQ ID NO: 44 (UCHT1 (Y182T)). In some embodiments, the antigen-binding domain that binds the protein associated with the TCR complex comprises an amino acid sequence having at least 85% sequence identity with the amino acid sequence of SEQ ID NO: 44 (UCHT1 (Y182T)). In some embodiments, the antigen-binding domain that binds the protein associated with the TCR complex comprises an amino acid sequence having at least 90% sequence identity with the amino acid sequence of SEQ ID NO: 44 (UCHT1 (Y182T)). In some embodiments, the antigen-binding domain that binds the protein associated with the TCR complex comprises an amino acid sequence having at least 95% sequence identity with the amino acid sequence of SEQ ID NO: 44 (UCHT1 (Y182T)). In some embodiments, the antigen-binding domain that binds the protein associated with the TCR complex comprises an amino acid sequence having at least 96% sequence identity with the amino acid sequence of SEQ ID NO: 44 (UCHT1 (Y182T)). In some embodiments, the antigen-binding domain that binds the protein associated with the TCR complex comprises an amino acid sequence having at least 97% sequence identity with the amino acid sequence of SEQ ID NO: 44 (UCHT1 (Y182T)). In some embodiments, the antigen-binding domain that binds the protein associated with the TCR complex comprises an amino acid sequence having at least 98% sequence identity with the amino acid sequence of SEQ ID NO: 44 (UCHT1 (Y182T)). In some embodiments, the antigen-binding domain that binds the protein associated with the TCR complex comprises an amino acid sequence having at least 99% sequence identity with the amino acid sequence of SEQ ID NO: 44 (UCHT1 (Y182T)). In some embodiments, the antigen-binding domain that binds the protein associated with the TCR complex comprises the amino acid sequence of SEQ ID NO: 44 (UCHT1 (Y182T)). In some embodiments, the CDR sequences of the antigen-binding domain that binds the protein associated with the TCR complex have 100% identity with the CDR sequences of the amino acid sequence of SEQ ID NO: 44 (UCHT1 (Y182T)) (i.e., the antigen-binding domain that binds the protein associated with the TCR complex comprises an amino acid sequence comprising a CDRH1. CDRH2. CDRH3, CDRL1, CDRL2, and CDRL3, each having 100% identity to the corresponding CDR in the amino acid sequence of SEQ ID NO: 44 (UCHT1 (Y182T)). In some embodiments, the CDR sequences of the antigen-binding domain that binds the protein associated with the TCR complex have 100% identity with the CDR sequences of the amino acid sequence of SEQ ID NO: 44 (UCHT1 (Y182T)), and the non-CDR (e.g., framework) sequences of the antigen-binding domain that binds the protein associated with the TCR complex have at least 80% sequence identity with the non-CDR (e.g., framework) sequences of the amino acid sequence of SEQ ID NO: 44 (UCHT1 (Y182T)). In some embodiments, the CDR sequences of the antigen-binding domain that binds the protein associated with the TCR complex have 100% identity with the CDR sequences of the amino acid sequence of SEQ ID NO: 44 (UCHT1 (Y182T)), and the non-CDR (e.g., framework) sequences of the antigen-binding domain that binds the protein associated with the TCR complex have at least 85% sequence identity with the non-CDR (e.g., framework) sequences of the amino acid sequence of SEQ ID NO: 44 (UCHT1 (Y182T)). In some embodiments, the CDR sequences of the antigen-binding domain that binds the protein associated with the TCR complex have 100% identity with the CDR sequences of the amino acid sequence of SEQ ID NO: 44 (UCHT1 (Y182T)), and the non-CDR (e.g., framework) sequences of the antigen-binding domain that binds the protein associated with the TCR complex have at least 90% sequence identity with the non-CDR (e.g., framework) sequences of the amino acid sequence of SEQ ID NO: 44 (UCHT1 (Y182T)). In some embodiments, the CDR sequences of the antigen-binding domain that binds the protein associated with the TCR complex have 100% identity with the CDR sequences of the amino acid sequence of SEQ ID NO: 44 (UCHT1 (Y182T)), and the non-CDR (e.g., framework) sequences of the antigen-binding domain that binds the protein associated with the TCR complex have at least 95% sequence identity with the non-CDR (e.g., framework) sequences of the amino acid sequence of SEQ ID NO: 44 (UCHT1 (Y182T)). In some embodiments, the CDR sequences of the antigen-binding domain that binds the protein associated with the TCR complex have 100% identity with the CDR sequences of the amino acid sequence of SEQ ID NO: 44 (UCHT1 (Y182T)), and the non-CDR (e.g., framework) sequences of the antigen-binding domain that binds the protein associated with the TCR complex have at least 96% sequence identity with the non-CDR (e.g., framework) sequences of the amino acid sequence of SEQ ID NO: 44 (UCHT1 (Y182T)). In some embodiments, the CDR sequences of the antigen-binding domain that binds the protein associated with the TCR complex have 100% identity with the CDR sequences of the amino acid sequence of SEQ ID NO: 44 (UCHT1 (Y182T)), and the non-CDR (e.g., framework) sequences of the antigen-binding domain that binds the protein associated with the TCR complex have at least 97% sequence identity with the non-CDR (e.g., framework) sequences of the amino acid sequence of SEQ ID NO: 44 (UCHT1 (Y182T)). In some embodiments, the CDR sequences of the antigen-binding domain that binds the protein associated with the TCR complex have 100% identity with the CDR sequences of the amino acid sequence of SEQ ID NO: 44 (UCHT1 (Y182T)), and the non-CDR (e.g., framework) sequences of the antigen-binding domain that binds the protein associated with the TCR complex have at least 98% sequence identity with the non-CDR (e.g., framework) sequences of the amino acid sequence of SEQ ID NO: 44 (UCHT1 (Y182T)). In some embodiments, the CDR sequences of the antigen-binding domain that binds the protein associated with the TCR complex have 100% identity with the CDR sequences of the amino acid sequence of SEQ ID NO: 44 (UCHT1 (Y182T)), and the non-CDR (e.g., framework) sequences of the antigen-binding domain that binds the protein associated with the TCR complex have at least 99% sequence identity with the non-CDR (e.g., framework) sequences of the amino acid sequence of SEQ ID NO: 44 (UCHT1 (Y182T)).
[0074] In some embodiments, the polynucleotide encoding the antigen-binding domain that binds the protein associated with the TCR complex comprises a nucleotide sequence having at least 70% sequence identity with the nucleotide sequence of SEQ ID NO: 39 (huUCHT1). In some embodiments, the polynucleotide encoding the antigen-binding domain that binds the protein associated with the TCR complex comprises a nucleotide sequence having at least 75% sequence identity with the nucleotide sequence of SEQ ID NO: 39 (huUCHT1). In some embodiments, the polynucleotide encoding the antigen-binding domain that binds the protein associated with the TCR complex comprises a nucleotide sequence having at least 80% sequence identity with the nucleotide sequence of SEQ ID NO: 39 (huUCHT1). In some embodiments, the polynucleotide encoding the antigen-binding domain that binds the protein associated with the TCR complex comprises a nucleotide sequence having at least 85% sequence identity with the nucleotide sequence of SEQ ID NO: 39 (huUCHT1). In some embodiments, the polynucleotide encoding the antigen-binding domain that binds the protein associated with the TCR complex comprises a nucleotide sequence having at least 90% sequence identity with the nucleotide sequence of SEQ ID NO: 39 (huUCHT1). In some embodiments, the polynucleotide encoding the antigen-binding domain that binds the protein associated with the TCR complex comprises a nucleotide sequence having at least 95% sequence identity with the nucleotide sequence of SEQ ID NO: 39 (huUCHT1). In some embodiments, the polynucleotide encoding the antigen-binding domain that binds the protein associated with the TCR complex comprises a nucleotide sequence having at least 96% sequence identity with the nucleotide sequence of SEQ ID NO: 39 (huUCHT1). In some embodiments, the polynucleotide encoding the antigen-binding domain that binds the protein associated with the TCR complex comprises a nucleotide sequence having at least 97% sequence identity with the nucleotide sequence of SEQ ID NO: 39 (huUCHT1). In some embodiments, the polynucleotide encoding the antigen-binding domain that binds the protein associated with the TCR complex comprises a nucleotide sequence having at least 98% sequence identity with the nucleotide sequence of SEQ ID NO: 39 (huUCHT1). In some embodiments, the polynucleotide encoding the antigen-binding domain that binds the protein associated with the TCR complex comprises a nucleotide sequence having at least 99% sequence identity with the nucleotide sequence of SEQ ID NO: 39 (huUCHT1). In some embodiments, the polynucleotide encoding the antigen-binding domain that binds the protein associated with the TCR complex comprises the nucleotide sequence of SEQ ID NO: 39 (huUCHT1).
[0075] In some embodiments, the antigen-binding domain that binds the protein associated with the TCR complex comprises an amino acid sequence having at least 70% sequence identity with the amino acid sequence of SEQ ID NO: 40 (huUCHT1). In some embodiments, the antigen-binding domain that binds the protein associated with the TCR complex comprises an amino acid sequence having at least 75% sequence identity with the amino acid sequence of SEQ ID NO: 40 (huUCHT1). In some embodiments, the antigen-binding domain that binds the protein associated with the TCR complex comprises an amino acid sequence having at least 80% sequence identity with the amino acid sequence of SEQ ID NO: 40 (huUCHT1). In some embodiments, the antigen-binding domain that binds the protein associated with the TCR complex comprises an amino acid sequence having at least 85% sequence identity with the amino acid sequence of SEQ ID NO: 40 (huUCHT1). In some embodiments, the antigen-binding domain that binds the protein associated with the TCR complex comprises an amino acid sequence having at least 90% sequence identity with the amino acid sequence of SEQ ID NO: 40 (huUCHT1). In some embodiments, the antigen-binding domain that binds the protein associated with the TCR complex comprises an amino acid sequence having at least 95% sequence identity with the amino acid sequence of SEQ ID NO: 40 (huUCHT1). In some embodiments, the antigen-binding domain that binds the protein associated with the TCR complex comprises an amino acid sequence having at least 96% sequence identity with the amino acid sequence of SEQ ID NO: 40 (huUCHT1). In some embodiments, the antigen-binding domain that binds the protein associated with the TCR complex comprises an amino acid sequence having at least 97% sequence identity with the amino acid sequence of SEQ ID NO: 40 (huUCHT1). In some embodiments, the antigen-binding domain that binds the protein associated with the TCR complex comprises an amino acid sequence having at least 98% sequence identity with the amino acid sequence of SEQ ID NO: 40 (huUCHT1). In some embodiments, the antigen-binding domain that binds the protein associated with the TCR complex comprises an amino acid sequence having at least 99% sequence identity with the amino acid sequence of SEQ ID NO: 40 (huUCHT1). In some embodiments, the antigen-binding domain that binds the protein associated with the TCR complex comprises the amino acid sequence of SEQ ID NO: 40 (huUCHT1). In some embodiments, the CDR sequences of the antigen-binding domain that binds the protein associated with the TCR complex have 100% identity with the CDR sequences of the amino acid sequence of SEQ ID NO: 40 (huUCHT1) (i.e., the antigen-binding domain that binds the protein associated with the TCR complex comprises an amino acid sequence comprising a CDRH1. CDRH2. CDRH3, CDRL1, CDRL2, and CDRL3, each having 100% identity to the corresponding CDR in the amino acid sequence of SEQ ID NO: 40 (huUCHT1). In some embodiments, the CDR sequences of the antigen-binding domain that binds the protein associated with the TCR complex have 100% identity with the CDR sequences of the amino acid sequence of SEQ ID NO: 40 (huUCHT1), and the non-CDR (e.g., framework) sequences of the antigen-binding domain that binds the protein associated with the TCR complex have at least 80% sequence identity with the non-CDR (e.g., framework) sequences of the amino acid sequence of SEQ ID NO: 40 (huUCHT1). In some embodiments, the CDR sequences of the antigen-binding domain that binds the protein associated with the TCR complex have 100% identity with the CDR sequences of the amino acid sequence of SEQ ID NO: 40 (huUCHT1), and the non-CDR (e.g., framework) sequences of the antigen-binding domain that binds the protein associated with the TCR complex have at least 85% sequence identity with the non-CDR (e.g., framework) sequences of the amino acid sequence of SEQ ID NO: 40 (huUCHT1). In some embodiments, the CDR sequences of the antigen-binding domain that binds the protein associated with the TCR complex have 100% identity with the CDR sequences of the amino acid sequence of SEQ ID NO: 40 (huUCHT1), and the non-CDR (e.g., framework) sequences of the antigen-binding domain that binds the protein associated with the TCR complex have at least 90% sequence identity with the non-CDR (e.g., framework) sequences of the amino acid sequence of SEQ ID NO: 40 (huUCHT1). In some embodiments, the CDR sequences of the antigen-binding domain that binds the protein associated with the TCR complex have 100% identity with the CDR sequences of the amino acid sequence of SEQ ID NO: 40 (huUCHT1), and the non-CDR (e.g., framework) sequences of the antigen-binding domain that binds the protein associated with the TCR complex have at least 95% sequence identity with the non-CDR (e.g., framework) sequences of the amino acid sequence of SEQ ID NO: 40 (huUCHT1). In some embodiments, the CDR sequences of the antigen-binding domain that binds the protein associated with the TCR complex have 100% identity with the CDR sequences of the amino acid sequence of SEQ ID NO: 40 (huUCHT1), and the non-CDR (e.g., framework) sequences of the antigen-binding domain that binds the protein associated with the TCR complex have at least 96% sequence identity with the non-CDR (e.g., framework) sequences of the amino acid sequence of SEQ ID NO: 40 (huUCHT1). In some embodiments, the CDR sequences of the antigen-binding domain that binds the protein associated with the TCR complex have 100% identity with the CDR sequences of the amino acid sequence of SEQ ID NO: 40 (huUCHT1), and the non-CDR (e.g., framework) sequences of the antigen-binding domain that binds the protein associated with the TCR complex have at least 97% sequence identity with the non-CDR (e.g., framework) sequences of the amino acid sequence of SEQ ID NO: 40 (huUCHT1). In some embodiments, the CDR sequences of the antigen-binding domain that binds the protein associated with the TCR complex have 100% identity with the CDR sequences of the amino acid sequence of SEQ ID NO: 40 (huUCHT1), and the non-CDR (e.g., framework) sequences of the antigen-binding domain that binds the protein associated with the TCR complex have at least 98% sequence identity with the non-CDR (e.g., framework) sequences of the amino acid sequence of SEQ ID NO: 40 (huUCHT1). In some embodiments, the CDR sequences of the antigen-binding domain that binds the protein associated with the TCR complex have 100% identity with the CDR sequences of the amino acid sequence of SEQ ID NO: 40 (huUCHT1), and the non-CDR (e.g., framework) sequences of the antigen-binding domain that binds the protein associated with the TCR complex have at least 99% sequence identity with the non-CDR (e.g., framework) sequences of the amino acid sequence of SEQ ID NO: 40 (huUCHT1).
[0076] In some embodiments, the polynucleotide encoding the antigen-binding domain that binds the protein associated with the TCR complex comprises a nucleotide sequence having at least 70% sequence identity with the nucleotide sequence of SEQ ID NO: 41 (huUCHT1 (Y177T)). In some embodiments, the polynucleotide encoding the antigen-binding domain that binds the protein associated with the TCR complex comprises a nucleotide sequence having at least 75% sequence identity with the nucleotide sequence of SEQ ID NO: 41 (huUCHT1 (Y177T)). In some embodiments, the polynucleotide encoding the antigen-binding domain that binds the protein associated with the TCR complex comprises a nucleotide sequence having at least 80% sequence identity with the nucleotide sequence of SEQ ID NO: 41 (huUCHT1 (Y177T)). In some embodiments, the polynucleotide encoding the antigen-binding domain that binds the protein associated with the TCR complex comprises a nucleotide sequence having at least 85% sequence identity with the nucleotide sequence of SEQ ID NO: 41 (huUCHT1 (Y177T)). In some embodiments, the polynucleotide encoding the antigen-binding domain that binds the protein associated with the TCR complex comprises a nucleotide sequence having at least 90% sequence identity with the nucleotide sequence of SEQ ID NO: 41 (huUCHT1 (Y177T)). In some embodiments, the polynucleotide encoding the antigen-binding domain that binds the protein associated with the TCR complex comprises a nucleotide sequence having at least 95% sequence identity with the nucleotide sequence of SEQ ID NO: 41 (huUCHT1 (Y177T)). In some embodiments, the polynucleotide encoding the antigen-binding domain that binds the protein associated with the TCR complex comprises a nucleotide sequence having at least 96% sequence identity with the nucleotide sequence of SEQ ID NO: 41 (huUCHT1 (Y177T)). In some embodiments, the polynucleotide encoding the antigen-binding domain that binds the protein associated with the TCR complex comprises a nucleotide sequence having at least 97% sequence identity with the nucleotide sequence of SEQ ID NO: 41 (huUCHT1 (Y177T)). In some embodiments, the polynucleotide encoding the antigen-binding domain that binds the protein associated with the TCR complex comprises a nucleotide sequence having at least 98% sequence identity with the nucleotide sequence of SEQ ID NO: 41 (huUCHT1 (Y177T)). In some embodiments, the polynucleotide encoding the antigen-binding domain that binds the protein associated with the TCR complex comprises a nucleotide sequence having at least 99% sequence identity with the nucleotide sequence of SEQ ID NO: 41 (huUCHT1 (Y177T)). In some embodiments, the polynucleotide encoding the antigen-binding domain that binds the protein associated with the TCR complex comprises the nucleotide sequence of SEQ ID NO: 41 (huUCHT1 (Y177T)).
[0077] In some embodiments, the antigen-binding domain that binds the protein associated with the TCR complex comprises an amino acid sequence having at least 70% sequence identity with the amino acid sequence of SEQ ID NO: 42 (huUCHT1 (Y177T)). In some embodiments, the antigen-binding domain that binds the protein associated with the TCR complex comprises an amino acid sequence having at least 75% sequence identity with the amino acid sequence of SEQ ID NO: 42 (huUCHT1 (Y177T)). In some embodiments, the antigen-binding domain that binds the protein associated with the TCR complex comprises an amino acid sequence having at least 80% sequence identity with the amino acid sequence of SEQ ID NO: 42 (huUCHT1 (Y177T)). In some embodiments, the antigen-binding domain that binds the protein associated with the TCR complex comprises an amino acid sequence having at least 85% sequence identity with the amino acid sequence of SEQ ID NO: 42 (huUCHT1 (Y177T)). In some embodiments, the antigen-binding domain that binds the protein associated with the TCR complex comprises an amino acid sequence having at least 90% sequence identity with the amino acid sequence of SEQ ID NO: 42 (huUCHT1 (Y177T)). In some embodiments, the antigen-binding domain that binds the protein associated with the TCR complex comprises an amino acid sequence having at least 95% sequence identity with the amino acid sequence of SEQ ID NO: 42 (huUCHT1 (Y177T)). In some embodiments, the antigen-binding domain that binds the protein associated with the TCR complex comprises an amino acid sequence having at least 96% sequence identity with the amino acid sequence of SEQ ID NO: 42 (huUCHT1 (Y177T)). In some embodiments, the antigen-binding domain that binds the protein associated with the TCR complex comprises an amino acid sequence having at least 97% sequence identity with the amino acid sequence of SEQ ID NO: 42 (huUCHT1 (Y177T)). In some embodiments, the antigen-binding domain that binds the protein associated with the TCR complex comprises an amino acid sequence having at least 98% sequence identity with the amino acid sequence of SEQ ID NO: 42 (huUCHT1 (Y177T)). In some embodiments, the antigen-binding domain that binds the protein associated with the TCR complex comprises an amino acid sequence having at least 99% sequence identity with the amino acid sequence of SEQ ID NO: 42 (huUCHT1 (Y177T)). In some embodiments, the antigen-binding domain that binds the protein associated with the TCR complex comprises the amino acid sequence of SEQ ID NO: 42 (huUCHT1 (Y177T)). In some embodiments, the CDR sequences of the antigen-binding domain that binds the protein associated with the TCR complex have 100% identity with the CDR sequences of the amino acid sequence of SEQ ID NO: 42 (huUCHT1 (Y177T)) (i.e., the antigen-binding domain that binds the protein associated with the TCR complex comprises an amino acid sequence comprising a CDRH1, CDRH2, CDRH3, CDRL1, CDRL2, and CDRL3, each having 100% identity to the corresponding CDR in the amino acid sequence of SEQ ID NO: 42 (huUCHT1 (Y177T)). In some embodiments, the CDR sequences of the antigen-binding domain that binds the protein associated with the TCR complex have 100% identity with the CDR sequences of the amino acid sequence of SEQ ID NO: 42 (huUCHT1 (Y177T)), and the non-CDR (e.g., framework) sequences of the antigen-binding domain that binds the protein associated with the TCR complex have at least 80% sequence identity with the non-CDR (e.g., framework) sequences of the amino acid sequence of SEQ ID NO: 42 (huUCHT1 (Y177T)). In some embodiments, the CDR sequences of the antigen-binding domain that binds the protein associated with the TCR complex have 100% identity with the CDR sequences of the amino acid sequence of SEQ ID NO: 42 (huUCHT1 (Y177T)), and the non-CDR (e.g., framework) sequences of the antigen-binding domain that binds the protein associated with the TCR complex have at least 85% sequence identity with the non-CDR (e.g., framework) sequences of the amino acid sequence of SEQ ID NO: 42 (huUCHT1 (Y177T)). In some embodiments, the CDR sequences of the antigen-binding domain that binds the protein associated with the TCR complex have 100% identity with the CDR sequences of the amino acid sequence of SEQ ID NO: 42 (huUCHT1 (Y177T)), and the non-CDR (e.g., framework) sequences of the antigen-binding domain that binds the protein associated with the TCR complex have at least 90% sequence identity with the non-CDR (e.g., framework) sequences of the amino acid sequence of SEQ ID NO: 42 (huUCHT1 (Y177T)). In some embodiments, the CDR sequences of the antigen-binding domain that binds the protein associated with the TCR complex have 100% identity with the CDR sequences of the amino acid sequence of SEQ ID NO: 42 (huUCHT1 (Y177T)), and the non-CDR (e.g., framework) sequences of the antigen-binding domain that binds the protein associated with the TCR complex have at least 95% sequence identity with the non-CDR (e.g., framework) sequences of the amino acid sequence of SEQ ID NO: 42 (huUCHT1 (Y177T)). In some embodiments, the CDR sequences of the antigen-binding domain that binds the protein associated with the TCR complex have 100% identity with the CDR sequences of the amino acid sequence of SEQ ID NO: 42 (huUCHT1 (Y177T)), and the non-CDR (e.g., framework) sequences of the antigen-binding domain that binds the protein associated with the TCR complex have at least 96% sequence identity with the non-CDR (e.g., framework) sequences of the amino acid sequence of SEQ ID NO: 42 (huUCHT1 (Y177T)). In some embodiments, the CDR sequences of the antigen-binding domain that binds the protein associated with the TCR complex have 100% identity with the CDR sequences of the amino acid sequence of SEQ ID NO: 42 (huUCHT1 (Y177T)), and the non-CDR (e.g., framework) sequences of the antigen-binding domain that binds the protein associated with the TCR complex have at least 97% sequence identity with the non-CDR (e.g., framework) sequences of the amino acid sequence of SEQ ID NO: 42 (huUCHT1 (Y177T)). In some embodiments, the CDR sequences of the antigen-binding domain that binds the protein associated with the TCR complex have 100% identity with the CDR sequences of the amino acid sequence of SEQ ID NO: 42 (huUCHT1 (Y177T)), and the non-CDR (e.g., framework) sequences of the antigen-binding domain that binds the protein associated with the TCR complex have at least 98% sequence identity with the non-CDR (e.g., framework) sequences of the amino acid sequence of SEQ ID NO: 42 (huUCHT1 (Y177T)). In some embodiments, the CDR sequences of the antigen-binding domain that binds the protein associated with the TCR complex have 100% identity with the CDR sequences of the amino acid sequence of SEQ ID NO: 42 (huUCHT1 (Y177T)), and the non-CDR (e.g., framework) sequences of the antigen-binding domain that binds the protein associated with the TCR complex have at least 99% sequence identity with the non-CDR (e.g., framework) sequences of the amino acid sequence of SEQ ID NO: 42 (huUCHT1 (Y177T)).
[0078] In some embodiments, the antigen-binding domain that binds to the protein associated with the TCR complex is OKT3. In some embodiments, the murine OKT3 antigen-binding domain is encoded by SEQ ID NO: 33. In some embodiments, the OKT3 antigen-binding domain comprises SEQ ID NO: 34.
[0079] In some embodiments, the polynucleotide encoding the antigen-binding domain that binds the protein associated with the TCR complex comprises a nucleotide sequence having at least 70% sequence identity with the nucleotide sequence of SEQ ID NO: 33(OKT3). In some embodiments, the polynucleotide encoding the antigen-binding domain that binds the protein associated with the TCR complex comprises a nucleotide sequence having at least 75% sequence identity with the nucleotide sequence of SEQ ID NO: 33(OKT3). In some embodiments, the polynucleotide encoding the antigen-binding domain that binds the protein associated with the TCR complex comprises a nucleotide sequence having at least 80% sequence identity with the nucleotide sequence of SEQ ID NO: 33(OKT3). In some embodiments, the polynucleotide encoding the antigen-binding domain that binds the protein associated with the TCR complex comprises a nucleotide sequence having at least 85% sequence identity with the nucleotide sequence of SEQ ID NO: 33(OKT3). In some embodiments, the polynucleotide encoding the antigen-binding domain that binds the protein associated with the TCR complex comprises a nucleotide sequence having at least 90% sequence identity with the nucleotide sequence of SEQ ID NO: 33(OKT3). In some embodiments, the polynucleotide encoding the antigen-binding domain that binds the protein associated with the TCR complex comprises a nucleotide sequence having at least 95% sequence identity with the nucleotide sequence of SEQ ID NO: 33(OKT3). In some embodiments, the polynucleotide encoding the antigen-binding domain that binds the protein associated with the TCR complex comprises a nucleotide sequence having at least 96% sequence identity with the nucleotide sequence of SEQ ID NO: 33(OKT3). In some embodiments, the polynucleotide encoding the antigen-binding domain that binds the protein associated with the TCR complex comprises a nucleotide sequence having at least 97% sequence identity with the nucleotide sequence of SEQ ID NO: 33(OKT3). In some embodiments, the polynucleotide encoding the antigen-binding domain that binds the protein associated with the TCR complex comprises a nucleotide sequence having at least 98% sequence identity with the nucleotide sequence of SEQ ID NO: 33(OKT3). In some embodiments, the polynucleotide encoding the antigen-binding domain that binds the protein associated with the TCR complex comprises a nucleotide sequence having at least 99% sequence identity with the nucleotide sequence of SEQ ID NO: 33(OKT3). In some embodiments, the polynucleotide encoding the antigen-binding domain that binds the protein associated with the TCR complex comprises the nucleotide sequence of SEQ ID NO: 33 (OKT3).
[0080] In some embodiments, the antigen-binding domain that binds the protein associated with the TCR complex comprises an amino acid sequence having at least 70% sequence identity with the amino acid sequence of SEQ ID NO: 34 (OKT3). In some embodiments, the antigen-binding domain that binds the protein associated with the TCR complex comprises an amino acid sequence having at least 75% sequence identity with the amino acid sequence of SEQ ID NO: 34 (OKT3). In some embodiments, the antigen-binding domain that binds the protein associated with the TCR complex comprises an amino acid sequence having at least 80% sequence identity with the amino acid sequence of SEQ ID NO: 34 (OKT3). In some embodiments, the antigen-binding domain that binds the protein associated with the TCR complex comprises an amino acid sequence having at least 85% sequence identity with the amino acid sequence of SEQ ID NO: 34 (OKT3). In some embodiments, the antigen-binding domain that binds the protein associated with the TCR complex comprises an amino acid sequence having at least 90% sequence identity with the amino acid sequence of SEQ ID NO: 34 (OKT3). In some embodiments, the antigen-binding domain that binds the protein associated with the TCR complex comprises an amino acid sequence having at least 95% sequence identity with the amino acid sequence of SEQ ID NO: 34 (OKT3). In some embodiments, the antigen-binding domain that binds the protein associated with the TCR complex comprises an amino acid sequence having at least 96% sequence identity with the amino acid sequence of SEQ ID NO: 34 (OKT3). In some embodiments, the antigen-binding domain that binds the protein associated with the TCR complex comprises an amino acid sequence having at least 97% sequence identity with the amino acid sequence of SEQ ID NO: 34 (OKT3). In some embodiments, the antigen-binding domain that binds the protein associated with the TCR complex comprises an amino acid sequence having at least 98% sequence identity with the amino acid sequence of SEQ ID NO: 34 (OKT3). In some embodiments, the antigen-binding domain that binds the protein associated with the TCR complex comprises an amino acid sequence having at least 99% sequence identity with the amino acid sequence of SEQ ID NO: 34 (OKT3). In some embodiments, the antigen-binding domain that binds the protein associated with the TCR complex comprises the amino acid sequence of SEQ ID NO: 34 (OKT3). In some embodiments, the CDR sequences of the antigen-binding domain that binds the protein associated with the TCR complex have 100% identity with the CDR sequences of the amino acid sequence of SEQ ID NO: 34 (OKT3) (i.e., the antigen-binding domain that binds the protein associated with the TCR complex comprises an amino acid sequence comprising a CDRH1, CDRH2, CDRH3, CDRL1, CDRL2, and CDRL3, each having 100% identity to the corresponding CDR in the amino acid sequence of SEQ ID NO: 34 (OKT3). In some embodiments, the CDR sequences of the antigen-binding domain that binds the protein associated with the TCR complex have 100% identity with the CDR sequences of the amino acid sequence of SEQ ID NO: 34 (OKT3), and the non-CDR (e.g., framework) sequences of the antigen-binding domain that binds the protein associated with the TCR complex have at least 80% sequence identity with the non-CDR (e.g., framework) sequences of the amino acid sequence of SEQ ID NO: 34 (OKT3). In some embodiments, the CDR sequences of the antigen-binding domain that binds the protein associated with the TCR complex have 100% identity with the CDR sequences of the amino acid sequence of SEQ ID NO: 34 (OKT3), and the non-CDR (e.g., framework) sequences of the antigen-binding domain that binds the protein associated with the TCR complex have at least 85% sequence identity with the non-CDR (e.g., framework) sequences of the amino acid sequence of SEQ ID NO: 34 (OKT3). In some embodiments, the CDR sequences of the antigen-binding domain that binds the protein associated with the TCR complex have 100% identity with the CDR sequences of the amino acid sequence of SEQ ID NO: 34 (OKT3), and the non-CDR (e.g., framework) sequences of the antigen-binding domain that binds the protein associated with the TCR complex have at least 90% sequence identity with the non-CDR (e.g., framework) sequences of the amino acid sequence of SEQ ID NO: 34 (OKT3). In some embodiments, the CDR sequences of the antigen-binding domain that binds the protein associated with the TCR complex have 100% identity with the CDR sequences of the amino acid sequence of SEQ ID NO: 34 (OKT3), and the non-CDR (e.g., framework) sequences of the antigen-binding domain that binds the protein associated with the TCR complex have at least 95% sequence identity with the non-CDR (e.g., framework) sequences of the amino acid sequence of SEQ ID NO: 34 (OKT3). In some embodiments, the CDR sequences of the antigen-binding domain that binds the protein associated with the TCR complex have 100% identity with the CDR sequences of the amino acid sequence of SEQ ID NO: 34 (OKT3), and the non-CDR (e.g., framework) sequences of the antigen-binding domain that binds the protein associated with the TCR complex have at least 96% sequence identity with the non-CDR (e.g., framework) sequences of the amino acid sequence of SEQ ID NO: 34 (OKT3). In some embodiments, the CDR sequences of the antigen-binding domain that binds the protein associated with the TCR complex have 100% identity with the CDR sequences of the amino acid sequence of SEQ ID NO: 34 (OKT3), and the non-CDR (e.g., framework) sequences of the antigen-binding domain that binds the protein associated with the TCR complex have at least 97% sequence identity with the non-CDR (e.g., framework) sequences of the amino acid sequence of SEQ ID NO: 34 (OKT3). In some embodiments, the CDR sequences of the antigen-binding domain that binds the protein associated with the TCR complex have 100% identity with the CDR sequences of the amino acid sequence of SEQ ID NO: 34 (OKT3), and the non-CDR (e.g., framework) sequences of the antigen-binding domain that binds the protein associated with the TCR complex have at least 98% sequence identity with the non-CDR (e.g., framework) sequences of the amino acid sequence of SEQ ID NO: 34 (OKT3). In some embodiments, the CDR sequences of the antigen-binding domain that binds the protein associated with the TCR complex have 100% identity with the CDR sequences of the amino acid sequence of SEQ ID NO: 34 (OKT3), and the non-CDR (e.g., framework) sequences of the antigen-binding domain that binds the protein associated with the TCR complex have at least 99% sequence identity with the non-CDR (e.g., framework) sequences of the amino acid sequence of SEQ ID NO: 34 (OKT3).
[0081] In some embodiments, the antigen-binding domain that binds to the protein associated with the TCR complex is F6A. In some embodiments, the murine F6A antigen-binding domain is encoded by SEQ ID NO: 35. In some embodiments, the F6A antigen-binding domain comprises SEQ ID NO: 36.
[0082] In some embodiments, the polynucleotide encoding the antigen-binding domain that binds the protein associated with the TCR complex comprises a nucleotide sequence having at least 70% sequence identity with the nucleotide sequence of SEQ ID NO: 35(F6A). In some embodiments, the polynucleotide encoding the antigen-binding domain that binds the protein associated with the TCR complex comprises a nucleotide sequence having at least 75% sequence identity with the nucleotide sequence of SEQ ID NO: 35(F6A). In some embodiments, the polynucleotide encoding the antigen-binding domain that binds the protein associated with the TCR complex comprises a nucleotide sequence having at least 80% sequence identity with the nucleotide sequence of SEQ ID NO: 35(F6A). In some embodiments, the polynucleotide encoding the antigen-binding domain that binds the protein associated with the TCR complex comprises a nucleotide sequence having at least 85% sequence identity with the nucleotide sequence of SEQ ID NO: 35(F6A). In some embodiments, the polynucleotide encoding the antigen-binding domain that binds the protein associated with the TCR complex comprises a nucleotide sequence having at least 90% sequence identity with the nucleotide sequence of SEQ ID NO: 35(F6A). In some embodiments, the polynucleotide encoding the antigen-binding domain that binds the protein associated with the TCR complex comprises a nucleotide sequence having at least 95% sequence identity with the nucleotide sequence of SEQ ID NO: 35(F6A). In some embodiments, the polynucleotide encoding the antigen-binding domain that binds the protein associated with the TCR complex comprises a nucleotide sequence having at least 96% sequence identity with the nucleotide sequence of SEQ ID NO: 35(F6A). In some embodiments, the polynucleotide encoding the antigen-binding domain that binds the protein associated with the TCR complex comprises a nucleotide sequence having at least 97% sequence identity with the nucleotide sequence of SEQ ID NO: 35 (F6A). In some embodiments, the polynucleotide encoding the antigen-binding domain that binds the protein associated with the TCR complex comprises a nucleotide sequence having at least 98% sequence identity with the nucleotide sequence of SEQ ID NO: 35(F6A). In some embodiments, the polynucleotide encoding the antigen-binding domain that binds the protein associated with the TCR complex comprises a nucleotide sequence having at least 99% sequence identity with the nucleotide sequence of SEQ ID NO: 35(F6A). In some embodiments, the polynucleotide encoding the antigen-binding domain that binds the protein associated with the TCR complex comprises the nucleotide sequence of SEQ ID NO: 35(F6A).
[0083] In some embodiments, the antigen-binding domain that binds the protein associated with the TCR complex comprises an amino acid sequence having at least 70% sequence identity with the amino acid sequence of SEQ ID NO: 36 (F6A). In some embodiments, the antigen-binding domain that binds the protein associated with the TCR complex comprises an amino acid sequence having at least 75% sequence identity with the amino acid sequence of SEQ ID NO: 36 (F6A). In some embodiments, the antigen-binding domain that binds the protein associated with the TCR complex comprises an amino acid sequence having at least 80% sequence identity with the amino acid sequence of SEQ ID NO: 36 (F6A). In some embodiments, the antigen-binding domain that binds the protein associated with the TCR complex comprises an amino acid sequence having at least 85% sequence identity with the amino acid sequence of SEQ ID NO: 36 (F6A). In some embodiments, the antigen-binding domain that binds the protein associated with the TCR complex comprises an amino acid sequence having at least 90% sequence identity with the amino acid sequence of SEQ ID NO: 36 (F6A). In some embodiments, the antigen-binding domain that binds the protein associated with the TCR complex comprises an amino acid sequence having at least 95% sequence identity with the amino acid sequence of SEQ ID NO: 36 (F6A). In some embodiments, the antigen-binding domain that binds the protein associated with the TCR complex comprises an amino acid sequence having at least 96% sequence identity with the amino acid sequence of SEQ ID NO: 36 (F6A). In some embodiments, the antigen-binding domain that binds the protein associated with the TCR complex comprises an amino acid sequence having at least 97% sequence identity with the amino acid sequence of SEQ ID NO: 36 (F6A). In some embodiments, the antigen-binding domain that binds the protein associated with the TCR complex comprises an amino acid sequence having at least 98% sequence identity with the amino acid sequence of SEQ ID NO: 36 (F6A). In some embodiments, the antigen-binding domain that binds the protein associated with the TCR complex comprises an amino acid sequence having at least 99% sequence identity with the amino acid sequence of SEQ ID NO: 36 (F6A). In some embodiments, the antigen-binding domain that binds the protein associated with the TCR complex comprises the amino acid sequence of SEQ ID NO: 36 (F6A). In some embodiments, the CDR sequences of the antigen-binding domain that binds the protein associated with the TCR complex have 100% identity with the CDR sequences of the amino acid sequence of SEQ ID NO: 36 (F6A) (i.e., the antigen-binding domain that binds the protein associated with the TCR complex comprises an amino acid sequence comprising a CDRH1, CDRH2, CDRH3, CDRL1, CDRL2, and CDRL3, each having 100% identity to the corresponding CDR in the amino acid sequence of SEQ ID NO: 36 (F6A). In some embodiments, the CDR sequences of the antigen-binding domain that binds the protein associated with the TCR complex have 100% identity with the CDR sequences of the amino acid sequence of SEQ ID NO: 36 (F6A), and the non-CDR (e.g., framework) sequences of the antigen-binding domain that binds the protein associated with the TCR complex have at least 80% sequence identity with the non-CDR (e.g., framework) sequences of the amino acid sequence of SEQ ID NO: 36 (F6A). In some embodiments, the CDR sequences of the antigen-binding domain that binds the protein associated with the TCR complex have 100% identity with the CDR sequences of the amino acid sequence of SEQ ID NO: 36 (F6A), and the non-CDR (e.g., framework) sequences of the antigen-binding domain that binds the protein associated with the TCR complex have at least 85% sequence identity with the non-CDR (e.g., framework) sequences of the amino acid sequence of SEQ ID NO: 36 (F6A). In some embodiments, the CDR sequences of the antigen-binding domain that binds the protein associated with the TCR complex have 100% identity with the CDR sequences of the amino acid sequence of SEQ ID NO: 36 (F6A), and the non-CDR (e.g., framework) sequences of the antigen-binding domain that binds the protein associated with the TCR complex have at least 90% sequence identity with the non-CDR (e.g., framework) sequences of the amino acid sequence of SEQ ID NO: 36 (F6A). In some embodiments, the CDR sequences of the antigen-binding domain that binds the protein associated with the TCR complex have 100% identity with the CDR sequences of the amino acid sequence of SEQ ID NO: 36 (F6A), and the non-CDR (e.g., framework) sequences of the antigen-binding domain that binds the protein associated with the TCR complex have at least 95% sequence identity with the non-CDR (e.g., framework) sequences of the amino acid sequence of SEQ ID NO: 36 (F6A). In some embodiments, the CDR sequences of the antigen-binding domain that binds the protein associated with the TCR complex have 100% identity with the CDR sequences of the amino acid sequence of SEQ ID NO: 36 (F6A), and the non-CDR (e.g., framework) sequences of the antigen-binding domain that binds the protein associated with the TCR complex have at least 96% sequence identity with the non-CDR (e.g., framework) sequences of the amino acid sequence of SEQ ID NO: 36 (F6A). In some embodiments, the CDR sequences of the antigen-binding domain that binds the protein associated with the TCR complex have 100% identity with the CDR sequences of the amino acid sequence of SEQ ID NO: 36 (F6A), and the non-CDR (e.g., framework) sequences of the antigen-binding domain that binds the protein associated with the TCR complex have at least 97% sequence identity with the non-CDR (e.g., framework) sequences of the amino acid sequence of SEQ ID NO: 36 (F6A). In some embodiments, the CDR sequences of the antigen-binding domain that binds the protein associated with the TCR complex have 100% identity with the CDR sequences of the amino acid sequence of SEQ ID NO: 36 (F6A), and the non-CDR (e.g., framework) sequences of the antigen-binding domain that binds the protein associated with the TCR complex have at least 98% sequence identity with the non-CDR (e.g., framework) sequences of the amino acid sequence of SEQ ID NO: 36 (F6A). In some embodiments, the CDR sequences of the antigen-binding domain that binds the protein associated with the TCR complex have 100% identity with the CDR sequences of the amino acid sequence of SEQ ID NO: 36 (F6A), and the non-CDR (e.g., framework) sequences of the antigen-binding domain that binds the protein associated with the TCR complex have at least 99% sequence identity with the non-CDR (e.g., framework) sequences of the amino acid sequence of SEQ ID NO: 36 (F6A).
[0084] In some embodiments, the antigen-binding domain that binds to the protein associated with the TCR complex is L2K. In some embodiments, the murine L2K antigen-binding domain is encoded by SEQ ID NO: 37. In some embodiments, the L2K antigen-binding domain comprises SEQ ID NO: 38.
[0085] In some embodiments, the polynucleotide encoding the antigen-binding domain that binds the protein associated with the TCR complex comprises a nucleotide sequence having at least 70% sequence identity with the nucleotide sequence of SEQ ID NO: 37 (L2K). In some embodiments, the polynucleotide encoding the antigen-binding domain that binds the protein associated with the TCR complex comprises a nucleotide sequence having at least 75% sequence identity with the nucleotide sequence of SEQ ID NO: 37 (L2K). In some embodiments, the polynucleotide encoding the antigen-binding domain that binds the protein associated with the TCR complex comprises a nucleotide sequence having at least 80% sequence identity with the nucleotide sequence of SEQ ID NO: 37 (L2K). In some embodiments, the polynucleotide encoding the antigen-binding domain that binds the protein associated with the TCR complex comprises a nucleotide sequence having at least 85% sequence identity with the nucleotide sequence of SEQ ID NO: 37 (L2K). In some embodiments, the polynucleotide encoding the antigen-binding domain that binds the protein associated with the TCR complex comprises a nucleotide sequence having at least 90% sequence identity with the nucleotide sequence of SEQ ID NO: 37 (L2K). In some embodiments, the polynucleotide encoding the antigen-binding domain that binds the protein associated with the TCR complex comprises a nucleotide sequence having at least 95% sequence identity with the nucleotide sequence of SEQ ID NO: 37 (L2K). In some embodiments, the polynucleotide encoding the antigen-binding domain that binds the protein associated with the TCR complex comprises a nucleotide sequence having at least 96% sequence identity with the nucleotide sequence of SEQ ID NO: 37 (L2K). In some embodiments, the polynucleotide encoding the antigen-binding domain that binds the protein associated with the TCR complex comprises a nucleotide sequence having at least 97% sequence identity with the nucleotide sequence of SEQ ID NO: 37 (L2K). In some embodiments, the polynucleotide encoding the antigen-binding domain that binds the protein associated with the TCR complex comprises a nucleotide sequence having at least 98% sequence identity with the nucleotide sequence of SEQ ID NO: 37 (L2K). In some embodiments, the polynucleotide encoding the antigen-binding domain that binds the protein associated with the TCR complex comprises a nucleotide sequence having at least 99% sequence identity with the nucleotide sequence of SEQ ID NO: 37 (L2K). In some embodiments, the polynucleotide encoding the antigen-binding domain that binds the protein associated with the TCR complex comprises the nucleotide sequence of SEQ ID NO: 37 (L2K).
[0086] In some embodiments, the antigen-binding domain that binds the protein associated with the TCR complex comprises an amino acid sequence having at least 70% sequence identity with the amino acid sequence of SEQ ID NO: 38 (L2K). In some embodiments, the antigen-binding domain that binds the protein associated with the TCR complex comprises an amino acid sequence having at least 75% sequence identity with the amino acid sequence of SEQ ID NO: 38 (L2K). In some embodiments, the antigen-binding domain that binds the protein associated with the TCR complex comprises an amino acid sequence having at least 80% sequence identity with the amino acid sequence of SEQ ID NO: 38 (L2K). In some embodiments, the antigen-binding domain that binds the protein associated with the TCR complex comprises an amino acid sequence having at least 85% sequence identity with the amino acid sequence of SEQ ID NO: 38 (L2K). In some embodiments, the antigen-binding domain that binds the protein associated with the TCR complex comprises an amino acid sequence having at least 90% sequence identity with the amino acid sequence of SEQ ID NO: 38 (L2K). In some embodiments, the antigen-binding domain that binds the protein associated with the TCR complex comprises an amino acid sequence having at least 95% sequence identity with the amino acid sequence of SEQ ID NO: 38 (L2K). In some embodiments, the antigen-binding domain that binds the protein associated with the TCR complex comprises an amino acid sequence having at least 96% sequence identity with the amino acid sequence of SEQ ID NO: 38 (L2K). In some embodiments, the antigen-binding domain that binds the protein associated with the TCR complex comprises an amino acid sequence having at least 97% sequence identity with the amino acid sequence of SEQ ID NO: 38 (L2K). In some embodiments, the antigen-binding domain that binds the protein associated with the TCR complex comprises an amino acid sequence having at least 98% sequence identity with the amino acid sequence of SEQ ID NO: 38 (L2K). In some embodiments, the antigen-binding domain that binds the protein associated with the TCR complex comprises an amino acid sequence having at least 99% sequence identity with the amino acid sequence of SEQ ID NO: 38 (L2K). In some embodiments, the antigen-binding domain that binds the protein associated with the TCR complex comprises the amino acid sequence of SEQ ID NO: 38 (L2K). In some embodiments, the CDR sequences of the antigen-binding domain that binds the protein associated with the TCR complex have 100% identity with the CDR sequences of the amino acid sequence of SEQ ID NO: 38 (L2K) (i.e., the antigen-binding domain that binds the protein associated with the TCR complex comprises an amino acid sequence comprising a CDRH1, CDRH2, CDRH3, CDRL1, CDRL2, and CDRL3, each having 100% identity to the corresponding CDR in the amino acid sequence of SEQ ID NO: 38 (L2K). In some embodiments, the CDR sequences of the antigen-binding domain that binds the protein associated with the TCR complex have 100% identity with the CDR sequences of the amino acid sequence of SEQ ID NO: 38 (L2K), and the non-CDR (e.g., framework) sequences of the antigen-binding domain that binds the protein associated with the TCR complex have at least 80% sequence identity with the non-CDR (e.g., framework) sequences of the amino acid sequence of SEQ ID NO: 38 (L2K). In some embodiments, the CDR sequences of the antigen-binding domain that binds the protein associated with the TCR complex have 100% identity with the CDR sequences of the amino acid sequence of SEQ ID NO: 38 (L2K), and the non-CDR (e.g., framework) sequences of the antigen-binding domain that binds the protein associated with the TCR complex have at least 85% sequence identity with the non-CDR (e.g., framework) sequences of the amino acid sequence of SEQ ID NO: 38 (L2K). In some embodiments, the CDR sequences of the antigen-binding domain that binds the protein associated with the TCR complex have 100% identity with the CDR sequences of the amino acid sequence of SEQ ID NO: 38 (L2K), and the non-CDR (e.g., framework) sequences of the antigen-binding domain that binds the protein associated with the TCR complex have at least 90% sequence identity with the non-CDR (e.g. framework) sequences of the amino acid sequence of SEQ ID NO: 38 (L2K). In some embodiments, the CDR sequences of the antigen-binding domain that binds the protein associated with the TCR complex have 100% identity with the CDR sequences of the amino acid sequence of SEQ ID NO: 38 (L2K), and the non-CDR (e.g., framework) sequences of the antigen-binding domain that binds the protein associated with the TCR complex have at least 95% sequence identity with the non-CDR (e.g., framework) sequences of the amino acid sequence of SEQ ID NO: 38 (L2K). In some embodiments, the CDR sequences of the antigen-binding domain that binds the protein associated with the TCR complex have 100% identity with the CDR sequences of the amino acid sequence of SEQ ID NO: 38 (L2K), and the non-CDR (e.g., framework) sequences of the antigen-binding domain that binds the protein associated with the TCR complex have at least 96% sequence identity with the non-CDR (e.g., framework) sequences of the amino acid sequence of SEQ ID NO: 38 (L2K). In some embodiments, the CDR sequences of the antigen-binding domain that binds the protein associated with the TCR complex have 100% identity with the CDR sequences of the amino acid sequence of SEQ ID NO: 38 (L2K), and the non-CDR (e.g., framework) sequences of the antigen-binding domain that binds the protein associated with the TCR complex have at least 97% sequence identity with the non-CDR (e.g., framework) sequences of the amino acid sequence of SEQ ID NO: 38 (L2K). In some embodiments, the CDR sequences of the antigen-binding domain that binds the protein associated with the TCR complex have 100% identity with the CDR sequences of the amino acid sequence of SEQ ID NO: 38 (L2K), and the non-CDR (e.g., framework) sequences of the antigen-binding domain that binds the protein associated with the TCR complex have at least 98% sequence identity with the non-CDR (e.g., framework) sequences of the amino acid sequence of SEQ ID NO: 38 (L2K). In some embodiments, the CDR sequences of the antigen-binding domain that binds the protein associated with the TCR complex have 100% identity with the CDR sequences of the amino acid sequence of SEQ ID NO: 38 (L2K), and the non-CDR (e.g., framework) sequences of the antigen-binding domain that binds the protein associated with the TCR complex have at least 99% sequence identity with the non-CDR (e.g., framework) sequences of the amino acid sequence of SEQ ID NO: 38 (L2K).
[0087] Amino acid and nucleotide sequences of exemplary antigen-binding domains that bind a protein associated with the TCR complex are provided in Table 1.
| TABLE 1 | ||
|---|---|---|
| Table of Sequences | ||
| SEQ ID NO | Description | Nucleotide/Amino Acid |
| SEQ ID NO: 31 | UCHT11 | Nucleotide |
| SEQ ID NO: 32 | UCHT12 | Amino Acid |
| SEQ ID NO: 33 | OKT3 | Nucleotide |
| SEQ ID NO: 34 | OKT3 | Amino Acid |
| SEQ ID NO: 35 | F6A | Nucleotide |
| SEQ ID NO: 36 | F6A | Amino Acid |
| SEQ ID NO: 37 | L2K | Nucleotide |
| SEQ ID NO: 38 | L2K | Amino Acid |
| SEQ ID NO: 39 | huUCHT1 | Nucleotide |
| SEQ ID NO: 40 | huUCHT1 | Amino Acid |
| SEQ ID NO: 41 | huUCHT1 (Y177T) | Nucleotide |
| SEQ ID NO: 42 | huUCHT1 (Y177T) | Amino Acid |
| SEQ ID NO: 43 | UCHT1 (Y182T) | Nucleotide |
| SEQ ID NO: 44 | UCHT1 (Y182T) | Amino Acid |
| 1Light chain, nucleotides 1-324; Linker, nucleotides 325-387; Heavy chain, nucleotides 388-750 | ||
| 2Light chain, amino acids 1-108; Linker, amino acids 109-128; Heavy chain, amino acids 129-250 | ||
Transmembrane Domain and Cytosolic Domain
[0088] In some embodiments, a GUCY2C T cell antigen coupler polypeptide comprises a T cell receptor signaling domain polypeptide. In some embodiments, a GUCY2C T cell antigen coupler polypeptide comprises a transmembrane domain of a TCR signaling domain. In some embodiments, a GUCY2C T cell antigen coupler polypeptide comprises a cytosolic domain of a TCR signaling domain polypeptide. In some embodiments, a GUCY2C T cell antigen coupler polypeptide comprises a transmembrane domain and a cytosolic domain of a TCR signaling domain polypeptide.
[0089] In some embodiments, the T cell receptor signaling domain polypeptide comprises a TCR co-receptor domain. In some embodiments, the TCR signaling domain polypeptide comprises a transmembrane domain and/or a cytosolic domain of a TCR co-receptor. In some embodiments, the TCR co-receptor is CD4, CD8, LAG3, or a chimeric variation thereof.
[0090] In some embodiments, the TCR co-receptor is CD4. In some embodiments, the GUCY2C TAC comprises a transmembrane domain and a cytosolic domain of a CD4 co-receptor. In some embodiments, the polynucleotide encoding the cytosolic and transmembrane domain comprises a nucleotide sequence having at least 70% sequence identity with the nucleotide sequence of SEQ ID NO: 45 (CD4 transmembrane and cytosolic domain). In some embodiments, the polynucleotide encoding the cytosolic and transmembrane domain comprises a nucleotide sequence having at least 75% sequence identity with the nucleotide sequence of SEQ ID NO: 45 (CD4 transmembrane and cytosolic domain). In some embodiments, the polynucleotide encoding the cytosolic and transmembrane domain comprises a nucleotide sequence having at least 80% sequence identity with the nucleotide sequence of SEQ ID NO: 45 (CD4 transmembrane and cytosolic domain). In some embodiments, the polynucleotide encoding the cytosolic and transmembrane domain comprises a nucleotide sequence having at least 85% sequence identity with the nucleotide sequence of SEQ ID NO: 45 (CD4 transmembrane and cytosolic domain). In some embodiments, the polynucleotide encoding the cytosolic and transmembrane domain comprises a nucleotide sequence having at least 90% sequence identity with the nucleotide sequence of SEQ ID NO: 45 (CD4 transmembrane and cytosolic domain). In some embodiments, the polynucleotide encoding the cytosolic and transmembrane domain comprises a nucleotide sequence having at least 95% sequence identity with the nucleotide sequence of SEQ ID NO: 45 (CD4 transmembrane and cytosolic domain). In some embodiments, the polynucleotide encoding the cytosolic and transmembrane domain comprises a nucleotide sequence having at least 96% sequence identity with the nucleotide sequence of SEQ ID NO: 45 (CD4 transmembrane and cytosolic domain). In some embodiments, the polynucleotide encoding the cytosolic and transmembrane domain comprises a nucleotide sequence having at least 97% sequence identity with the nucleotide sequence of SEQ ID NO: 45 (CD4 transmembrane and cytosolic domain). In some embodiments, the polynucleotide encoding the cytosolic and transmembrane domain comprises a nucleotide sequence having at least 98% sequence identity with the nucleotide sequence of SEQ ID NO: 45 (CD4 transmembrane and cytosolic domain). In some embodiments, the polynucleotide encoding the cytosolic and transmembrane domain comprises a nucleotide sequence having at least 99% sequence identity with the nucleotide sequence of SEQ ID NO: 45 (CD4 transmembrane and cytosolic domain). In some embodiments, the polynucleotide encoding the cytosolic and transmembrane domain comprises the nucleotide sequence of SEQ ID NO: 45 (CD4 transmembrane and cytosolic domain). In some embodiments, the cytosolic and transmembrane domain comprise an amino acid sequence having at least 70% sequence identity with the amino acid sequence of SEQ ID NO: 46 (CD4 transmembrane and cytosolic domain). In some embodiments, the cytosolic and transmembrane domain comprise an amino acid sequence having at least 75% sequence identity with the amino acid sequence of SEQ ID NO: 46 (CD4 transmembrane and cytosolic domain). In some embodiments, the cytosolic and transmembrane domain comprise an amino acid sequence having at least 80% sequence identity with the amino acid sequence of SEQ ID NO: 46 (CD4 transmembrane and cytosolic domain). In some embodiments, the cytosolic and transmembrane domain comprise an amino acid sequence having at least 85% sequence identity with the amino acid sequence of SEQ ID NO: 46 (CD4 transmembrane and cytosolic domain). In some embodiments, the cytosolic and transmembrane domain comprise an amino acid sequence having at least 90% sequence identity with the amino acid sequence of SEQ ID NO: 46 (CD4 transmembrane and cytosolic domain). In some embodiments, the cytosolic and transmembrane domain comprise an amino acid sequence having at least 95% sequence identity with the amino acid sequence of SEQ ID NO: 46 (CD4 transmembrane and cytosolic domain). In some embodiments, the cytosolic and transmembrane domain comprise an amino acid sequence having at least 96% sequence identity with the amino acid sequence of SEQ ID NO: 46 (CD4 transmembrane and cytosolic domain). In some embodiments, the cytosolic and transmembrane domain comprise an amino acid sequence having at least 97% sequence identity with the amino acid sequence of SEQ ID NO: 46 (CD4 transmembrane and cytosolic domain). In some embodiments, the cytosolic and transmembrane domain comprise an amino acid sequence having at least 98% sequence identity with the amino acid sequence of SEQ ID NO: 46 (CD4 transmembrane and cytosolic domain). In some embodiments, the cytosolic and transmembrane domain comprise an amino acid sequence having at least 99% sequence identity with the amino acid sequence of SEQ ID NO: 46 (CD4 transmembrane and cytosolic domain). In some embodiments, the cytosolic and transmembrane domain comprise the amino acid sequence of SEQ ID NO: 46 (CD4 transmembrane and cytosolic domain).
[0091] In some embodiments, the TCR co-receptor is CD8. In some embodiments, the TCR co-receptor is CD8α. In some embodiments, the polynucleotide encoding the cytosolic and transmembrane domain comprises a nucleotide sequence having at least 70% sequence identity with the nucleotide sequence of SEQ ID NO: 47 (CD8 transmembrane and cytosolic domain). In some embodiments, the polynucleotide encoding the cytosolic and transmembrane domain comprises a nucleotide sequence having at least 75% sequence identity with the nucleotide sequence of SEQ ID NO: 47 (CD8 transmembrane and cytosolic domain). In some embodiments, the polynucleotide encoding the cytosolic and transmembrane domain comprises a nucleotide sequence having at least 80% sequence identity with the nucleotide sequence of SEQ ID NO: 47 (CD8 transmembrane and cytosolic domain). In some embodiments, the polynucleotide encoding the cytosolic and transmembrane domain comprises a nucleotide sequence having at least 85% sequence identity with the nucleotide sequence of SEQ ID NO: 47 (CD8 transmembrane and cytosolic domain). In some embodiments, the polynucleotide encoding the cytosolic and transmembrane domain comprises a nucleotide sequence having at least 90% sequence identity with the nucleotide sequence of SEQ ID NO: 47 (CD8 transmembrane and cytosolic domain). In some embodiments, the polynucleotide encoding the cytosolic and transmembrane domain comprises a nucleotide sequence having at least 95% sequence identity with the nucleotide sequence of SEQ ID NO: 47 (CD8 transmembrane and cytosolic domain). In some embodiments, the polynucleotide encoding the cytosolic and transmembrane domain comprises a nucleotide sequence having at least 96% sequence identity with the nucleotide sequence of SEQ ID NO: 47 (CD8 transmembrane and cytosolic domain). In some embodiments, the polynucleotide encoding the cytosolic and transmembrane domain comprises a nucleotide sequence having at least 97% sequence identity with the nucleotide sequence of SEQ ID NO: 47 (CD8 transmembrane and cytosolic domain). In some embodiments, the polynucleotide encoding the cytosolic and transmembrane domain comprises a nucleotide sequence having at least 98% sequence identity with the nucleotide sequence of SEQ ID NO: 47 (CD8 transmembrane and cytosolic domain). In some embodiments, the polynucleotide encoding the cytosolic and transmembrane domain comprises a nucleotide sequence having at least 99% sequence identity with the nucleotide sequence of SEQ ID NO: 47 (CD8 transmembrane and cytosolic domain). In some embodiments, the polynucleotide encoding the cytosolic and transmembrane domain comprises the nucleotide sequence of SEQ ID NO: 47 (CD8 transmembrane and cytosolic domain). In some embodiments, the cytosolic and transmembrane domain comprise an amino acid sequence having at least 70% sequence identity with the amino acid sequence of SEQ ID NO: 48 (CD8 transmembrane and cytosolic domain). In some embodiments, the cytosolic and transmembrane domain comprise an amino acid sequence having at least 75% sequence identity with the amino acid sequence of SEQ ID NO: 48 (CD8 transmembrane and cytosolic domain). In some embodiments, the cytosolic and transmembrane domain comprise an amino acid sequence having at least 80% sequence identity with the amino acid sequence of SEQ ID NO: 48 (CD8 transmembrane and cytosolic domain). In some embodiments, the cytosolic and transmembrane domain comprise an amino acid sequence having at least 85% sequence identity with the amino acid sequence of SEQ ID NO: 48 (CD8 transmembrane and cytosolic domain). In some embodiments, the cytosolic and transmembrane domain comprise an amino acid sequence having at least 90% sequence identity with the amino acid sequence of SEQ ID NO: 48 (CD8 transmembrane and cytosolic domain). In some embodiments, the cytosolic and transmembrane domain comprise an amino acid sequence having at least 95% sequence identity with the amino acid sequence of SEQ ID NO: 48 (CD8 transmembrane and cytosolic domain). In some embodiments, the cytosolic and transmembrane domain comprise an amino acid sequence having at least 96% sequence identity with the amino acid sequence of SEQ ID NO: 48 (CD8 transmembrane and cytosolic domain). In some embodiments, the cytosolic and transmembrane domain comprise an amino acid sequence having at least 97% sequence identity with the amino acid sequence of SEQ ID NO: 48 (CD8 transmembrane and cytosolic domain). In some embodiments, the cytosolic and transmembrane domain comprise an amino acid sequence having at least 98% sequence identity with the amino acid sequence of SEQ ID NO: 48 (CD8 transmembrane and cytosolic domain). In some embodiments, the cytosolic and transmembrane domain comprise an amino acid sequence having at least 99% sequence identity with the amino acid sequence of SEQ ID NO: 48 (CD8 transmembrane and cytosolic domain). In some embodiments, the cytosolic and transmembrane domain comprise the amino acid sequence of SEQ ID NO: 48 (CD8 transmembrane and cytosolic domain).
[0092] In some embodiments, the TCR signaling domain polypeptide comprises a chimera of sequences or domains from co-receptors. In some embodiments, the TCR signaling domain polypeptide comprises a chimera of CD8α and CD8β, wherein the CD8α arginine rich region is replaced with the CD8β arginine rich region (CD8α+R(β) chimera). In some embodiments, the polynucleotide encoding the cytosolic and transmembrane domain comprises a nucleotide sequence having at least 70% sequence identity with the nucleotide sequence of SEQ ID NO: 49 (CD8α+R(β) chimera). In some embodiments, the polynucleotide encoding the cytosolic and transmembrane domain comprises a nucleotide sequence having at least 75% sequence identity with the nucleotide sequence of SEQ ID NO: 49 (CD8α+R(β) chimera). In some embodiments, the polynucleotide encoding the cytosolic and transmembrane domain comprises a nucleotide sequence having at least 80% sequence identity with the nucleotide sequence of SEQ ID NO: 49 (CD8α+R(β) chimera). In some embodiments, the polynucleotide encoding the cytosolic and transmembrane domain comprises a nucleotide sequence having at least 85% sequence identity with the nucleotide sequence of SEQ ID NO: 49 (CD8α+R(β) chimera). In some embodiments, the polynucleotide encoding the cytosolic and transmembrane domain comprises a nucleotide sequence having at least 90% sequence identity with the nucleotide sequence of SEQ ID NO: 49 (CD8α+R(β) chimera). In some embodiments, the polynucleotide encoding the cytosolic and transmembrane domain comprises a nucleotide sequence having at least 95% sequence identity with the nucleotide sequence of SEQ ID NO: 49 (CD8α+R(β) chimera). In some embodiments, the polynucleotide encoding the cytosolic and transmembrane domain comprises a nucleotide sequence having at least 96% sequence identity with the nucleotide sequence of SEQ ID NO: 49 (CD8α+R(β) chimera). In some embodiments, the polynucleotide encoding the cytosolic and transmembrane domain comprises a nucleotide sequence having at least 97% sequence identity with the nucleotide sequence of SEQ ID NO: 49 (CD8α+R(β) chimera). In some embodiments, the polynucleotide encoding the cytosolic and transmembrane domain comprises a nucleotide sequence having at least 98% sequence identity with the nucleotide sequence of SEQ ID NO: 49 (CD8α+R(β) chimera). In some embodiments, the polynucleotide encoding the cytosolic and transmembrane domain comprises a nucleotide sequence having at least 99% sequence identity with the nucleotide sequence of SEQ ID NO: 49 (CD8α+R(β) chimera). In some embodiments, the polynucleotide encoding the cytosolic and transmembrane domain comprises the nucleotide sequence of SEQ ID NO: 49 (CD8α+R(β) chimera). In some embodiments, the cytosolic and transmembrane domain comprise an amino acid sequence having at least 70% sequence identity with the amino acid sequence of SEQ ID NO: 50 (CD8α+R(β) chimera). In some embodiments, the cytosolic and transmembrane domain comprise an amino acid sequence having at least 75% sequence identity with the amino acid sequence of SEQ ID NO: 50 (CD8α+R(β) chimera). In some embodiments, the cytosolic and transmembrane domain comprise an amino acid sequence having at least 80% sequence identity with the amino acid sequence of SEQ ID NO: 50 (CD8α+R(β) chimera). In some embodiments, the cytosolic and transmembrane domain comprise an amino acid sequence having at least 85% sequence identity with the amino acid sequence of SEQ ID NO: 50 (CD8α+R(β) chimera). In some embodiments, the cytosolic and transmembrane domain comprise an amino acid sequence having at least 90% sequence identity with the amino acid sequence of SEQ ID NO: 50 (CD8α+R(β) chimera). In some embodiments, the cytosolic and transmembrane domain comprise an amino acid sequence having at least 95% sequence identity with the amino acid sequence of SEQ ID NO: 50 (CD8α+R(β) chimera). In some embodiments, the cytosolic and transmembrane domain comprise an amino acid sequence having at least 96% sequence identity with the amino acid sequence of SEQ ID NO: 50 (CD8α+R(β) chimera). In some embodiments, the cytosolic and transmembrane domain comprise an amino acid sequence having at least 97% sequence identity with the amino acid sequence of SEQ ID NO: 50 (CD8α+R(β) chimera). In some embodiments, the cytosolic and transmembrane domain comprise an amino acid sequence having at least 98% sequence identity with the amino acid sequence of SEQ ID NO: 50 (CD8α+R(β) chimera). In some embodiments, the cytosolic and transmembrane domain comprise an amino acid sequence having at least 99% sequence identity with the amino acid sequence of SEQ ID NO: 50 (CD8α+R(β) chimera). In some embodiments, the cytosolic and transmembrane domain comprise the amino acid sequence of SEQ ID NO: 50 (CD8α+R(β) chimera).
[0093] In some embodiments, the TCR signaling domain polypeptide comprises a chimera of CD8α and CD8β, where the CD8α CXCP domain, which contains an Lck binding motif, is appended to the C-terminus of the CD8β cytosolic domain (CD8β+Lck chimera). In some embodiments, the polynucleotide encoding the cytosolic and transmembrane domain comprises a nucleotide sequence having at least 70% sequence identity with the nucleotide sequence of SEQ ID NO: 51 (CD8β+Lck chimera). In some embodiments, the polynucleotide encoding the cytosolic and transmembrane domain comprises a nucleotide sequence having at least 75% sequence identity with the nucleotide sequence of SEQ ID NO: 51 (CD8β+Lck chimera). In some embodiments, the polynucleotide encoding the cytosolic and transmembrane domain comprises a nucleotide sequence having at least 80% sequence identity with the nucleotide sequence of SEQ ID NO: 51 (CD8β+Lck chimera). In some embodiments, the polynucleotide encoding the cytosolic and transmembrane domain comprises a nucleotide sequence having at least 85% sequence identity with the nucleotide sequence of SEQ ID NO: 51 (CD8β+Lck chimera). In some embodiments, the polynucleotide encoding the cytosolic and transmembrane domain comprises a nucleotide sequence having at least 90% sequence identity with the nucleotide sequence of SEQ ID NO: 51 (CD8β+Lck chimera). In some embodiments, the polynucleotide encoding the cytosolic and transmembrane domain comprises a nucleotide sequence having at least 95% sequence identity with the nucleotide sequence of SEQ ID NO: 51 (CD8β+Lck chimera). In some embodiments, the polynucleotide encoding the cytosolic and transmembrane domain comprises a nucleotide sequence having at least 96% sequence identity with the nucleotide sequence of SEQ ID NO: 51 (CD8β+Lck chimera). In some embodiments, the polynucleotide encoding the cytosolic and transmembrane domain comprises a nucleotide sequence having at least 97% sequence identity with the nucleotide sequence of SEQ ID NO: 51 (CD8β+Lck chimera). In some embodiments, the polynucleotide encoding the cytosolic and transmembrane domain comprises a nucleotide sequence having at least 98% sequence identity with the nucleotide sequence of SEQ ID NO: 51 (CD8β+Lck chimera). In some embodiments, the polynucleotide encoding the cytosolic and transmembrane domain comprises a nucleotide sequence having at least 99% sequence identity with the nucleotide sequence of SEQ ID NO: 51 (CD8β+Lck chimera). In some embodiments, the polynucleotide encoding the cytosolic and transmembrane domain comprises the nucleotide sequence of SEQ ID NO: 51 (CD8β+Lck chimera). In some embodiments, the cytosolic and transmembrane domain comprise an amino acid sequence having at least 70% sequence identity with the amino acid sequence of SEQ ID NO: 52 (CD8β+Lck chimera). In some embodiments, the cytosolic and transmembrane domain comprise an amino acid sequence having at least 75% sequence identity with the amino acid sequence of SEQ ID NO: 52 (CD8(3+Lck chimera). In some embodiments, the cytosolic and transmembrane domain comprise an amino acid sequence having at least 80% sequence identity with the amino acid sequence of SEQ ID NO: 52 (CD8β+Lck chimera). In some embodiments, the cytosolic and transmembrane domain comprise an amino acid sequence having at least 85% sequence identity with the amino acid sequence of SEQ ID NO: 52 (CD8(3+Lck chimera). In some embodiments, the cytosolic and transmembrane domain comprise an amino acid sequence having at least 90% sequence identity with the amino acid sequence of SEQ ID NO: 52 (CD8β+Lck chimera). In some embodiments, the cytosolic and transmembrane domain comprise an amino acid sequence having at least 95% sequence identity with the amino acid sequence of SEQ ID NO: 52 (CD8β+Lck chimera). In some embodiments, the cytosolic and transmembrane domain comprise an amino acid sequence having at least 96% sequence identity with the amino acid sequence of SEQ ID NO: 52 (CD8β+Lck chimera). In some embodiments, the cytosolic and transmembrane domain comprise an amino acid sequence having at least 97% sequence identity with the amino acid sequence of SEQ ID NO: 52 (CD8β+Lck chimera). In some embodiments, the cytosolic and transmembrane domain comprise an amino acid sequence having at least 98% sequence identity with the amino acid sequence of SEQ ID NO: 52 (CD8β+Lck chimera). In some embodiments, the cytosolic and transmembrane domain comprise an amino acid sequence having at least 99% sequence identity with the amino acid sequence of SEQ ID NO: 52 (CD8β+Lck chimera). In some embodiments, the cytosolic and transmembrane domain comprise the amino acid sequence of SEQ ID NO: 52 (CD8β+Lck chimera).
[0094] In some embodiments, the TCR signaling domain polypeptide includes both a cytosolic domain and a transmembrane domain of a TCR co-receptor protein. In some embodiments, the cytosolic domain and transmembrane domain are from the same co-receptor or from different co-receptors.
[0095] Amino acid and nucleotide sequences of exemplary transmembrane and cytosolic domains are provided in Table 2.
| TABLE 2 | ||
|---|---|---|
| Table of Sequences | ||
| SEQ ID NO | Description | Nucleotide/Amino Acid |
| SEQ ID NO: 45 | CD4 Domain1 | Nucleotide |
| SEQ ID NO: 46 | CD4 Domain2 | Amino Acid |
| SEQ ID NO: 47 | CD8α Domain | Nucleotide |
| SEQ ID NO: 48 | CD8α Domain | Amino Acid |
| SEQ ID NO: 49 | CD8α + R(β) Domain | Nucleotide |
| SEQ ID NO: 50 | CD8α + R(β) Domain | Amino Acid |
| SEQ ID NO: 51 | CD8 α + Lck Domain | Nucleotide |
| SEQ ID NO: 52 | CD8 α + Lck Domain | Amino Acid |
| 1Extracellular linker, nucleotides 1-66; Transmembrane domain, nucleotides 67-132; Cytosolic domain, nucleotides 133-254 | ||
| 2Extracellular linker, amino acids 1-22; Transmembrane domain, amino acids 23-44; Cytosolic domain, amino acids 45-84 | ||
Configurations, Linkers, and Connectors
[0096] In some embodiments, a nucleic acid disclosed herein is in an order of (1) a first polynucleotide encoding an antigen-binding domain that binds GUCY2C; (2) a second polynucleotide encoding an antigen-binding domain that binds a TCR complex; (3) a third polynucleotide encoding a transmembrane domain and a cytosolic domain. In some embodiments, a nucleic acid disclosed herein is in an order of (1) a first polynucleotide encoding an antigen-binding domain that binds GUCY2C; (2) a second polynucleotide encoding an antigen-binding domain that binds a TCR complex; (3) a third polynucleotide encoding a transmembrane domain and a cytosolic domain, wherein the order is 5′ end to 3′ end. In some embodiments, a nucleic acid disclosed herein is in an order of (1) a first polynucleotide encoding an antigen-binding domain that binds GUCY2C; (2) a second polynucleotide encoding an antigen-binding domain that binds a TCR complex; (3) a third polynucleotide encoding a transmembrane domain and a cytosolic domain, wherein the order is 3′ end to 5′ end. In some embodiments, a nucleic acid described herein is in an order of (1) a first polynucleotide encoding an antigen-binding domain that binds a TCR complex; (2) a second polynucleotide encoding an antigen-binding domain that binds GUCY2C; (3) a third polynucleotide encoding a transmembrane domain and a cytosolic domain. In some embodiments, a nucleic acid described herein is in an order of (1) a first polynucleotide encoding an antigen-binding domain that binds a TCR complex; (2) a second polynucleotide encoding an antigen-binding domain that binds GUCY2C; (3) a third polynucleotide encoding a transmembrane domain and a cytosolic domain, wherein the order is 5′ end to 3′ end. In some embodiments, a nucleic acid described herein is in an order of (1) a first polynucleotide encoding an antigen-binding domain that binds a TCR complex; (2) a second polynucleotide encoding an antigen-binding domain that binds GUCY2C: (3) a third polynucleotide encoding a transmembrane domain and a cytosolic domain, wherein the order is 3′ end to 5′ end.
[0097] In some embodiments, a GUCY2C TAC polypeptide disclosed herein is in an order of (1) an antigen-binding domain that binds GUCY2C; (2) an antigen-binding domain that binds a TCR complex; (3) a transmembrane domain and a cytosolic domain, wherein the order is N-terminus to C-terminus. In some embodiments, a GUCY2C TAC polypeptide disclosed herein is in an order of (1) an antigen-binding domain that binds GUCY2C; (2) an antigen-binding domain that binds a TCR complex; (3) a transmembrane domain and a cytosolic domain, wherein the order is C-terminus to N-terminus. In some embodiments, a GUCY2C TAC polypeptide described herein is in an order of (1) an antigen-binding domain that binds a TCR complex; (2) an antigen-binding domain that binds GUCY2C; (3) a transmembrane domain and a cytosolic domain, wherein the order is N-terminus to C-terminus. In some embodiments, a GUCY2C TAC polypeptide described herein is in an order of (1) an antigen-binding domain that binds a TCR complex; (2) an antigen-binding domain that binds GUCY2C; (3) a transmembrane domain and a cytosolic domain, wherein the order is C-terminus to N-terminus.
[0098] In some embodiments, the antigen-binding domain that binds GUCY2C, the antigen-binding domain that binds the TCR complex, and/or the transmembrane domain and cytosolic domain are directly fused. For example, the antigen-binding domain that binds GUCY2C and the transmembrane domain and cytosolic domain are both fused to the antigen-binding domain that binds the TCR complex. In some embodiments, the antigen-binding domain that binds GUCY2C, the antigen-binding domain that binds the TCR complex, and/or the transmembrane domain and cytosolic domain are joined by at least one linker. In some embodiments, the antigen-binding domain that binds GUCY2C and the antigen-binding domain that binds the TCR complex are directly fused, and joined to the transmembrane domain and cytosolic domain by a linker. In some embodiments, the antigen-binding domain that binds the TCR complex and the transmembrane domain and cytosolic domain are directly fused, and joined to the antigen-binding domain that binds GUCY2C by a linker.
[0099] In some embodiments, the linker is a peptide linker. In some embodiments, the peptide linker comprises 1 to 40 amino acids. In some embodiments, the peptide linker comprises 1 to 30 amino acids. In some embodiments, the peptide linker comprises 1 to 15 amino acids. In some embodiments, the peptide linker comprises 1 to 10 amino acids. In some embodiments, the peptide linker comprises 1 to 6 amino acids. In some embodiments, the peptide linker comprises 30 to 40 amino acids. In some embodiments, the peptide linker comprises 32 to 36 amino acids. In some embodiments, the peptide linker comprises 5 to 30 amino acids. In some embodiments, the peptide linker comprises 5 amino acids. In some embodiments, the peptide linker comprises 10 amino acids. In some embodiments, the peptide linker comprises 15 amino acids. In some embodiments, the peptide linker comprises 20 amino acids. In some embodiments, the peptide linker comprises 25 amino acids. In some embodiments, the peptide linker comprises 30 amino acids. In some embodiments, the peptide linker comprises a glycine and/or serine-rich linker.
[0100] In some embodiments, the at least one linker comprises an amino acid sequence having at least 80% identity with the amino acid sequence of SEQ ID NO: 26 ((G4S)4-based linker), SEQ ID NO: 28 (G4S-based linker), SEQ ID NO: 6 (linker 1), SEQ ID NO: 8 (linker 2), SEQ ID NO: 10 (CD4 based linker), SEQ ID NO: 12 (short helix connector), SEQ ID NO: 14 (long helix connector), SEQ ID NO: 16 (large domain connector), SEQ ID NO: 22 (Whitlow), or SEQ ID NO: 24 (G4S3 linker). In some embodiments, the at least one linker comprises an amino acid sequence having at least 85% identity with the amino acid sequence of SEQ ID NO: 26 ((G4S)4-based linker), SEQ ID NO: 28 (G4S-based linker), SEQ ID NO: 6 (linker 1), SEQ ID NO: 8 (linker 2), SEQ ID NO: 10 (CD4 based linker), SEQ ID NO: 12 (short helix connector), SEQ ID NO: 14 (long helix connector), SEQ ID NO: 16 (large domain connector), SEQ ID NO: 22 (Whitlow), or SEQ ID NO: 24 (G4S3 linker). In some embodiments, the at least one linker comprises an amino acid sequence having at least 90% identity with the amino acid sequence of SEQ ID NO: 26 ((G4S)4-based linker), SEQ ID NO: 28 (G4S-based linker), SEQ ID NO: 6 (linker 1), SEQ ID NO: 8 (linker 2), SEQ ID NO: 10 (CD4 based linker). SEQ ID NO: 12 (short helix connector), SEQ ID NO: 14 (long helix connector), SEQ ID NO: 16 (large domain connector), SEQ ID NO: 22 (Whitlow), or SEQ ID NO: 24 (G4S3 linker). In some embodiments, the at least one linker comprises an amino acid sequence having at least 95% identity with the amino acid sequence of SEQ ID NO: 26 ((G4S)4-based linker), SEQ ID NO: 28 (G4S-based linker). SEQ ID NO: 6 (linker 1), SEQ ID NO: 8 (linker 2). SEQ ID NO: 10 (CD4 based linker), SEQ ID NO: 12 (short helix connector), SEQ ID NO: 14 (long helix connector), SEQ ID NO: 16 (large domain connector), SEQ ID NO: 22 (Whitlow), or SEQ ID NO: 24 (G4S3 linker). In some embodiments, the at least one linker comprises an amino acid sequence having at least 96% identity with the amino acid sequence of SEQ ID NO: 26 ((G4S)4-based linker), SEQ ID NO: 28 (G4S-based linker), SEQ ID NO: 6 (linker 1), SEQ ID NO: 8 (linker 2), SEQ ID NO: 10 (CD4 based linker), SEQ ID NO: 12 (short helix connector), SEQ ID NO: 14 (long helix connector), SEQ ID NO: 16 (large domain connector), SEQ ID NO: 22 (Whitlow), or SEQ ID NO: 24 (G4S3 linker). In some embodiments, the at least one linker comprises an amino acid sequence having at least 97% identity with the amino acid sequence of SEQ ID NO: 26 ((G4S)4-based linker), SEQ ID NO: 28 (G4S-based linker), SEQ ID NO: 6 (linker 1), SEQ ID NO: 8 (linker 2), SEQ ID NO: 10 (CD4 based linker), SEQ ID NO: 12 (short helix connector), SEQ ID NO: 14 (long helix connector), SEQ ID NO: 16 (large domain connector). SEQ ID NO: 22 (Whitlow), or SEQ ID NO: 24 (G4S3 linker). In some embodiments, the at least one linker comprises an amino acid sequence having at least 98% identity with the amino acid sequence of SEQ ID NO: 26 ((G4S)4-based linker), SEQ ID NO: 28 (G4S-based linker), SEQ ID NO: 6 (linker 1), SEQ ID NO: 8 (linker 2), SEQ ID NO: 10 (CD4 based linker), SEQ ID NO: 12 (short helix connector), SEQ ID NO: 14 (long helix connector), SEQ ID NO: 16 (large domain connector), SEQ ID NO: 22 (Whitlow), or SEQ ID NO: 24 (G4S3 linker). In some embodiments, the at least one linker comprises an amino acid sequence having at least 99% identity with the amino acid sequence of SEQ ID NO: 26 ((G4S)4-based linker), SEQ ID NO: 28 (G4S-based linker), SEQ ID NO: 6 (linker 1), SEQ ID NO: 8 (linker 2), SEQ ID NO: 10 (CD4 based linker), SEQ ID NO: 12 (short helix connector), SEQ ID NO: 14 (long helix connector). SEQ ID NO: 16 (large domain connector), SEQ ID NO: 22 (Whitlow), or SEQ ID NO: 24 (G4S3 linker). In some embodiments, the at least one linker comprises the amino acid sequence of SEQ ID NO: 26 ((G4S)4-based linker), SEQ ID NO: 28 (G4S-based linker), SEQ ID NO: 6 (linker 1), SEQ ID NO: 8 (linker 2), SEQ ID NO: 10 (CD4 based linker), SEQ ID NO: 12 (short helix connector). SEQ ID NO: 14 (long helix connector), SEQ ID NO: 16 (large domain connector), SEQ ID NO: 22 (Whitlow), or SEQ ID NO: 24 (G4S3 linker).
[0101] In some embodiments, the at least one linker comprises a nucleotide sequence having at least 80% identity with the nucleotide sequence of SEQ ID NO: 25 ((G4S)4-based linker), SEQ ID NO: 27 (G4S-based linker), SEQ ID NO: 5 (linker 1), SEQ ID NO: 7 (linker 2), SEQ ID NO: 9 (CD4 based linker), SEQ ID NO: 11 (short helix connector), SEQ ID NO: 13 (long helix connector). SEQ ID NO: 15 (large domain connector), SEQ ID NO: 21 (Whitlow), or SEQ ID NO: 23 (G4S3 linker). In some embodiments, the at least one linker comprises a nucleotide sequence having at least 85% identity with the nucleotide sequence of SEQ ID NO: 25 ((G4S)4-based linker), SEQ ID NO: 27 (G4S-based linker), SEQ ID NO: 5 (linker 1), SEQ ID NO: 7 (linker 2), SEQ ID NO: 9 (CD4 based linker). SEQ ID NO: 11 (short helix connector). SEQ ID NO: 13 (long helix connector), SEQ ID NO: 15 (large domain connector), SEQ ID NO: 21 (Whitlow), or SEQ ID NO: 23 (G4S3 linker). In some embodiments, the at least one linker comprises a nucleotide sequence having at least 90% identity with the nucleotide sequence of SEQ ID NO: 25 ((G4S)4-based linker), SEQ ID NO: 27 (G4S-based linker), SEQ ID NO: 5 (linker 1), SEQ ID NO: 7 (linker 2). SEQ ID NO: 9 (CD4 based linker), SEQ ID NO: 11 (short helix connector), SEQ ID NO: 13 (long helix connector), SEQ ID NO: 15 (large domain connector), SEQ ID NO: 21 (Whitlow), or SEQ ID NO: 23 (G4S3 linker). In some embodiments, the at least one linker comprises a nucleotide sequence having at least 95% identity with the nucleotide sequence of SEQ ID NO: 25 ((G4S)4-based linker), SEQ ID NO: 27 (G4S-based linker), SEQ ID NO: 5 (linker 1), SEQ ID NO: 7 (linker 2). SEQ ID NO: 9 (CD4 based linker), SEQ ID NO: 11 (short helix connector), SEQ ID NO: 13 (long helix connector), SEQ ID NO: 15 (large domain connector), SEQ ID NO: 21 (Whitlow), or SEQ ID NO: 23 (G4S3 linker). In some embodiments, the at least one linker comprises a nucleotide sequence having at least 96% identity with the nucleotide sequence of SEQ ID NO: 25 ((G4S)4-based linker), SEQ ID NO: 27 (G4S-based linker), SEQ ID NO: 5 (linker 1), SEQ ID NO: 7 (linker 2), SEQ ID NO: 9 (CD4 based linker), SEQ ID NO: 11 (short helix connector), SEQ ID NO: 13 (long helix connector). SEQ ID NO: 15 (large domain connector), SEQ ID NO: 21 (Whitlow), or SEQ ID NO: 23 (G4S3 linker). In some embodiments, the at least one linker comprises a nucleotide sequence having at least 97% identity with the nucleotide sequence of SEQ ID NO: 25 ((G4S)4-based linker), SEQ ID NO: 27 (G4S-based linker), SEQ ID NO: 5 (linker 1), SEQ ID NO: 7 (linker 2), SEQ ID NO: 9 (CD4 based linker). SEQ ID NO: 11 (short helix connector). SEQ ID NO: 13 (long helix connector), SEQ ID NO: 15 (large domain connector). SEQ ID NO: 21 (Whitlow), or SEQ ID NO: 23 (G4S3 linker). In some embodiments, the at least one linker comprises a nucleotide sequence having at least 98% identity with the nucleotide sequence of SEQ ID NO: 25 ((G4S)4-based linker), SEQ ID NO: 27 (G4S-based linker), SEQ ID NO: 5 (linker 1), SEQ ID NO: 7 (linker 2), SEQ ID NO: 9 (CD4 based linker), SEQ ID NO: 11 (short helix connector), SEQ ID NO: 13 (long helix connector), SEQ ID NO: 15 (large domain connector), SEQ ID NO: 21 (Whitlow), or SEQ ID NO: 23 (G4S3 linker). In some embodiments, the at least one linker comprises a nucleotide sequence having at least 99% identity with the nucleotide sequence of SEQ ID NO: 25 ((G4S)4-based linker), SEQ ID NO: 27 (G4S-based linker), SEQ ID NO: 5 (linker 1), SEQ ID NO: 7 (linker 2). SEQ ID NO: 9 (CD4 based linker), SEQ ID NO: 11 (short helix connector), SEQ ID NO: 13 (long helix connector), SEQ ID NO: 15 (large domain connector), SEQ ID NO: 21 (Whitlow), or SEQ ID NO: 23 (G4S3 linker). In some embodiments, the at least one linker comprises the nucleotide sequence of SEQ ID NO: 25 ((G4S)4-based linker), SEQ ID NO: 27 (G4S-based linker), SEQ ID NO: 5 (linker 1), SEQ ID NO: 7 (linker 2), SEQ ID NO: 9 (CD4 based linker), SEQ ID NO: 11 (short helix connector), SEQ ID NO: 13 (long helix connector), SEQ ID NO: 15 (large domain connector). SEQ ID NO: 21 (Whitlow), or SEQ ID NO: 23 (G4S3 linker).
[0102] In some embodiments, the peptide linker that joins the antigen-binding domain that binds GUCY2C to the antigen-binding domain that binds a TCR complex (e.g., UCHT1) is known as the connector to distinguish this protein domain from other linkers in the TAC. The connector may be of any size. In some embodiments, the connector between the antigen-binding domain that binds a TCR complex and the antigen-binding domain that binds GUCY2C is a short helix comprising SEQ ID NO: 12. In some embodiments, the connector between the antigen-binding domain that binds a TCR complex and the antigen-binding domain that binds GUCY2C is a short helix encoded by SEQ ID NO: 11. In some embodiments, the connector between the antigen-binding domain that binds a TCR complex and the antigen-binding domain that binds GUCY2C is a long helix comprising SEQ ID NO: 14. In some embodiments, the connector between the antigen-binding domain that binds a TCR complex and the antigen-binding domain that binds GUCY2C is a long helix encoded by SEQ ID NO: 13. In some embodiments, the connector between the antigen-binding domain that binds a TCR complex and the antigen-binding domain that binds GUCY2C is a large domain comprising SEQ ID NO: 16. In some embodiments, the connector between the antigen-binding domain that binds a TCR complex and the antigen-binding domain that binds GUCY2C is a large domain encoded by SEQ ID NO: 15.
[0103] In some embodiments, a nucleic acid or TAC disclosed herein comprises a leader sequence. In some embodiments, the leader sequence is encoded by a nucleotide sequence having at least 80% sequence identity with the nucleotide sequence of SEQ ID NO: 1 (muIgG leader), SEQ ID NO: 17 (huIgG leader), SEQ ID NO: 19 (huCD8a leader), or SEQ ID NO: 29 (huCD8a leader). In some embodiments, the leader sequence is encoded by a nucleotide sequence having at least 85% sequence identity with the nucleotide sequence of SEQ ID NO: 1 (muIgG leader), SEQ ID NO: 17 (huIgG leader), SEQ ID NO: 19 (huCD8a leader), or SEQ ID NO: 29 (huCD8a leader). In some embodiments, the leader sequence is encoded by a nucleotide sequence having at least 90% sequence identity with the nucleotide sequence of SEQ ID NO: 1 (muIgG leader), SEQ ID NO: 17 (huIgG leader), SEQ ID NO: 19 (huCD8a leader), or SEQ ID NO: 29 (huCD8a leader). In some embodiments, the leader sequence is encoded by a nucleotide sequence having at least 95% sequence identity with the nucleotide sequence of SEQ ID NO: 1 (muIgG leader), SEQ ID NO: 17 (huIgG leader), SEQ ID NO: 19 (huCD8a leader), or SEQ ID NO: 29 (huCD8a leader). In some embodiments, the leader sequence is encoded by a nucleotide sequence having at least 96% sequence identity with the nucleotide sequence of SEQ ID NO: 1 (muIgG leader), SEQ ID NO: 17 (huIgG leader), SEQ ID NO: 19 (huCD8a leader), or SEQ ID NO: 29 (huCD8a leader). In some embodiments, the leader sequence is encoded by a nucleotide sequence having at least 97% sequence identity with the nucleotide sequence of SEQ ID NO: 1 (muIgG leader), SEQ ID NO: 17 (huIgG leader), SEQ ID NO: 19 (huCD8a leader), or SEQ ID NO: 29 (huCD8a leader). In some embodiments, the leader sequence is encoded by a nucleotide sequence having at least 98% sequence identity with the nucleotide sequence of SEQ ID NO: 1 (muIgG leader), SEQ ID NO: 17 (huIgG leader), SEQ ID NO: 19 (huCD8a leader), or SEQ ID NO: 29 (huCD8a leader). In some embodiments, the leader sequence is encoded by a nucleotide sequence having at least 99% sequence identity with the nucleotide sequence of SEQ ID NO: 1 (muIgG leader), SEQ ID NO: 17 (huIgG leader), SEQ ID NO: 19 (huCD8a leader), or SEQ ID NO: 29 (huCD8a leader). In some embodiments, the leader sequence comprises the nucleotide sequence of SEQ ID NO: 1 (muIgG leader). SEQ ID NO: 17 (huIgG leader), SEQ ID NO: 19 (huCD8a leader), or SEQ ID NO: 29 (huCD8a leader).
[0104] In some embodiments, a nucleic acid or TAC disclosed herein comprises a leader sequence. In some embodiments, the leader sequence comprises an amino acid sequence having at least 80% sequence identity with the amino acid sequence of SEQ ID NO: 2 (muIgG leader), SEQ ID NO: 18 (huIgG leader). SEQ ID NO: 20 (huCD8a leader), or SEQ ID NO: 30 (huCD8a leader). In some embodiments, the leader sequence comprises an amino acid sequence having at least 85% sequence identity with the amino acid sequence of SEQ ID NO: 2 (muIgG leader), SEQ ID NO: 18 (huIgG leader), SEQ ID NO: 20 (huCD8a leader), or SEQ ID NO: 30 (huCD8a leader). In some embodiments, the leader sequence comprises an amino acid sequence having at least 90% sequence identity with the amino acid sequence of SEQ ID NO: 2 (muIgG leader), SEQ ID NO: 18 (huIgG leader), SEQ ID NO: 20 (huCD8α leader), or SEQ ID NO: 30 (huCD8α leader). In some embodiments, the leader sequence comprises an amino acid sequence having at least 95% sequence identity with the amino acid sequence of SEQ ID NO: 2 (muIgG leader), SEQ ID NO: 18 (huIgG leader), SEQ ID NO: 20 (huCD8α leader), or SEQ ID NO: 30 (huCD8α leader). In some embodiments, the leader sequence comprises an amino acid sequence having at least 96% sequence identity with the amino acid sequence of SEQ ID NO: 2 (muIgG leader), SEQ ID NO: 18 (huIgG leader). SEQ ID NO: 20 (huCD8α leader), or SEQ ID NO: 30 (huCD8α leader). In some embodiments, the leader sequence comprises an amino acid sequence having at least 97% sequence identity with the amino acid sequence of SEQ ID NO: 2 (muIgG leader), SEQ ID NO: 18 (huIgG leader), SEQ ID NO: 20 (huCD8α leader), or SEQ ID NO: 30 (huCD8α leader). In some embodiments, the leader sequence comprises an amino acid sequence having at least 98% sequence identity with the amino acid sequence of SEQ ID NO: 2 (muIgG leader), SEQ ID NO: 18 (huIgG leader), SEQ ID NO: 20 (huCD8α leader), or SEQ ID NO: 30 (huCD8α leader). In some embodiments, the leader sequence comprises an amino acid sequence having at least 99% sequence identity with the amino acid sequence of SEQ ID NO: 2 (muIgG leader), SEQ ID NO: 18 (huIgG leader). SEQ ID NO: 20 (huCD8α leader), or SEQ ID NO: 30 (huCD8α leader). In some embodiments, the leader sequence comprises the amino acid sequence of SEQ ID NO: 2 (muIgG leader), SEQ ID NO: 18 (huIgG leader), SEQ ID NO: 20 (huCD8α leader), or SEQ ID NO: 30 (huCD8α leader).
[0105] In some embodiments, a GUCY2C T cell antigen coupler polypeptide comprises a tag. e.g., a Myc tag. In some embodiments, the tag comprises an amino acid sequence having at least 80% identity with the amino acid sequence of SEQ ID NO: 4 (Myc Tag). In some embodiments, the tag comprises an amino acid sequence having at least 85% identity with the amino acid sequence of SEQ ID NO: 4 (Myc Tag). In some embodiments, the tag comprises an amino acid sequence having at least 90% identity with the amino acid sequence of SEQ ID NO: 4 (Myc Tag). In some embodiments, the tag comprises an amino acid sequence having at least 95% identity with the amino acid sequence of SEQ ID NO: 4 (Myc Tag). In some embodiments, the tag comprises an amino acid sequence having at least 96% identity with the amino acid sequence of SEQ ID NO: 4 (Myc Tag). In some embodiments, the tag comprises an amino acid sequence having at least 97% identity with the amino acid sequence of SEQ ID NO: 4 (Myc Tag). In some embodiments, the tag comprises an amino acid sequence having at least 98% identity with the amino acid sequence of SEQ ID NO: 4 (Myc Tag). In some embodiments, the tag comprises an amino acid sequence having at least 99% identity with the amino acid sequence of SEQ ID NO: 4 (Myc Tag). In some embodiments, the tag comprises the amino acid sequence of SEQ ID NO: 4 (Myc Tag).
[0106] In some embodiments, the tag comprises a nucleotide sequence having at least 80% identity with the nucleotide sequence of SEQ ID NO: 3 (Myc Tag). In some embodiments, the tag comprises a nucleotide sequence having at least 85% identity with the nucleotide sequence of SEQ ID NO: 3 (Myc Tag). In some embodiments, the tag comprises a nucleotide sequence having at least 90% identity with the nucleotide sequence of SEQ ID NO: 3 (Myc Tag). In some embodiments, the tag comprises a nucleotide sequence having at least 95% identity with the nucleotide sequence of SEQ ID NO: 3 (Myc Tag). In some embodiments, the tag comprises a nucleotide sequence having at least 96% identity with the nucleotide sequence of SEQ ID NO: 3 (Myc Tag). In some embodiments, the tag comprises a nucleotide sequence having at least 97% identity with the nucleotide sequence of SEQ ID NO: 3 (Myc Tag). In some embodiments, the tag comprises a nucleotide sequence having at least 98% identity with the nucleotide sequence of SEQ ID NO: 3 (Myc Tag). In some embodiments, the tag comprises a nucleotide sequence having at least 99% identity with the nucleotide sequence of SEQ ID NO: 3 (Myc Tag). In some embodiments, the tag comprises the nucleotide sequence of SEQ ID NO: 3 (Myc Tag).
[0107] Amino acid and nucleotide sequences of exemplary linkers, connectors, tags, and leader sequences are provided in Table 3.
| TABLE 3 | ||
|---|---|---|
| Table of Sequences | ||
| SEQ ID NO | Description | Nucleotide/Amino Acid |
| SEQ ID NO: 1 | muIgG leader (secretion signal) | Nucleotide |
| SEQ ID NO: 2 | muIgG leader (secretion signal) | Amino Acid |
| SEQ ID NO: 3 | Myc Tag | Nucleotide |
| SEQ ID NO: 4 | Myc Tag | Amino Acid |
| SEQ ID NO: 5 | Linker 1 | Nucleotide |
| SEQ ID NO: 6 | Linker 1 | Amino Acid |
| SEQ ID NO: 7 | Linker 2 | Nucleotide |
| SEQ ID NO: 8 | Linker 2 | Amino Acid |
| SEQ ID NO: 9 | CD4 linker | Nucleotide |
| SEQ ID NO: 10 | CD4 linker | Amino Acid |
| SEQ ID NO: 11 | Short Helix connector | Nucleotide |
| SEQ ID NO: 12 | Short Helix connector | Amino Acid |
| SEQ ID NO: 13 | Long Helix connector | Nucleotide |
| SEQ ID NO: 14 | Long Helix connector | Amino Acid |
| SEQ ID NO: 15 | Large domain connector | Nucleotide |
| SEQ ID NO: 16 | Large domain connector | Amino Acid |
| SEQ ID NO: 17 | huIgG | Nucleotide |
| SEQ ID NO: 18 | huIgG | Amino Acid |
| SEQ ID NO: 19 | huCD8a -1 | Nucleotide |
| SEQ ID NO: 20 | huCD8a -1 | Amino Acid |
| SEQ ID NO: 21 | Whitlow Linker | Nucleotide |
| SEQ ID NO: 22 | Whitlow Linker | Amino Acid |
| SEQ ID NO: 23 | (G4S)3 linker | Nucleotide |
| SEQ ID NO: 24 | (G4S)3 linker | Amino Acid |
| SEQ ID NO: 25 | (G4S)4 linker | Nucleotide |
| SEQ ID NO: 26 | (G4S)4 linker | Amino Acid |
| SEQ ID NO: 27 | G4S linker | Nucleotide |
| SEQ ID NO: 28 | G4S linker | Amino Acid |
| SEQ ID NO: 29 | huCD8a -2 | Nucleotide |
| SEQ ID NO: 30 | huCD8a -2 | Amino Acid |
GUCY2C Antigen-Binding Domain
[0108] In certain embodiments, the GUCY2C TAC polypeptide comprises a GUCY2C antigen-binding domain. In some embodiments, the GUCY2C antigen-binding domain selectively binds GUCY2C. In some embodiments, the GUCY2C antigen-binding domain binds to GUCY2C on a target cell. In some embodiments, a target cell is a cell associated with a disease state, including, but not limited to, cancer. In some embodiments, a target cell is a tumor cell.
[0109] In some embodiments, the GUCY2C antigen-binding domain is an antibody or a fragment thereof. In some embodiments, the GUCY2C antigen-binding domain is selected from single chain antibodies (e.g., single-chain fragment variable antibodies (scFvs)), single domain antibodies (e.g., heavy-chain-only antibodies (VHH), shark heavy-chain-only antibodies (VNAR)), nanobodies, diabodies, minibodies. Fab fragments. Fab′ fragments, F(ab′)2 fragments, or Fv fragments that bind to GUCY2C. In some embodiments, the GUCY2C antigen-binding domain is a nanobody. In some embodiments, the GUCY2C antigen-binding domain is selected from an amino acid sequence according to any one of SEQ ID NOs: 53-71.
[0110] In some embodiments, the GUCY2C antigen-binding domain comprises an amino acid sequence having at least 80% sequence identity with an amino acid sequence according to any one of SEQ ID NOs: 53-71. In some embodiments, the GUCY2C antigen-binding domain comprises an amino acid sequence having at least 85% sequence identity with an amino acid sequence according to any one of SEQ ID NOs: 53-71. In some embodiments, the GUCY2C antigen-binding domain comprises an amino acid sequence having at least 90% sequence identity an amino acid sequence according to any one of SEQ ID NOs: 53-71. In some embodiments, the GUCY2C antigen-binding domain comprises an amino acid sequence having at least 95% sequence identity with an amino acid sequence according to any one of SEQ ID NOs: 53-71. In some embodiments, the GUCY2C antigen-binding domain comprises an amino acid sequence having at least 96% sequence identity an amino acid sequence according to any one of SEQ ID NOs: 53-71. In some embodiments, the GUCY2C antigen-binding domain comprises an amino acid sequence having at least 97% sequence identity with an amino acid sequence according to any one of SEQ ID NOs: 53-71. In some embodiments, the GUCY2C antigen-binding domain comprises an amino acid sequence having at least 98% sequence identity with an amino acid sequence according to any one of SEQ ID NOs: 53-71. In some embodiments, the GUCY2C antigen-binding domain comprises an amino acid sequence having at least 99% sequence identity with an amino acid sequence according to any one of SEQ ID NOs: 53-71.
[0111] In some embodiments, the GUCY2C antigen-binding domain comprises an amino acid sequence at least 80% identical to an amino acid sequence according to any one of SEQ ID NOs: 53-71. In some embodiments, the GUCY2C antigen-binding domain comprises an amino acid sequence at least 85% identical to an amino acid sequence according to any one of SEQ ID NOs: 53-71. In some embodiments, the GUCY2C antigen-binding domain comprises an amino acid sequence at least 90% identical to an amino acid sequence according to any one of SEQ ID NOs: 53-71. In some embodiments, the GUCY2C antigen-binding domain comprises an amino acid sequence at least 95% identical to an amino acid sequence according to any one of SEQ ID NOs: 53-71. In some embodiments, the GUCY2C antigen-binding domain comprises an amino acid sequence at least 96% identical to an amino acid sequence according to any one of SEQ ID NOs: 53-71. In some embodiments, the GUCY2C antigen-binding domain comprises an amino acid sequence at least 97% identical to an amino acid sequence according to any one of SEQ ID NOs: 53-71. In some embodiments, the GUCY2C antigen-binding domain comprises an amino acid sequence at least 98% identical to an amino acid sequence according to any one of SEQ ID NOs: 53-71. In some embodiments, the GUCY2C antigen-binding domain comprises an amino acid sequence at least 99% identical to an amino acid sequence according to any one of SEQ ID NOs: 53-71.
[0112] In some embodiments, the GUCY2C antigen-binding domain comprises an amino acid sequence at least 80% identical to an amino acid sequence according to any one of SEQ ID NOs: 53-62, and comprises CDR1, CDR2, and CDR3 sequences of SEQ ID NOs: 72-74, respectively.
[0113] In some embodiments, the GUCY2C antigen-binding domain comprises an amino acid sequence at least 85% identical to an amino acid sequence according to any one of SEQ ID NOs: 53-62, and comprises CDR1, CDR2, and CDR3 sequences of SEQ ID NOs: 72-74, respectively. In some embodiments, the GUCY2C antigen-binding domain comprises an amino acid sequence at least 90% identical to an amino acid sequence according to any one of SEQ ID NOs: 53-62, and comprises CDR1, CDR2, and CDR3 sequences of SEQ ID NOs: 72-74, respectively. In some embodiments, the GUCY2C antigen-binding domain comprises an amino acid sequence at least 95% identical to an amino acid sequence according to any one of SEQ ID NOs: 53-62, and comprises CDR1, CDR2, and CDR3 sequences of SEQ ID NOs: 72-74, respectively. In some embodiments, the GUCY2C antigen-binding domain comprises an amino acid sequence at least 96% identical to an amino acid sequence according to any one of SEQ ID NOs: 53-62, and comprises CDR1, CDR2, and CDR3 sequences of SEQ ID NOs: 72-74, respectively. In some embodiments, the GUCY2C antigen-binding domain comprises an amino acid sequence at least 97% identical to an amino acid sequence according to any one of SEQ ID NOs: 53-62, and comprises CDR1, CDR2, and CDR3 sequences of SEQ ID NOs: 72-74, respectively. In some embodiments, the GUCY2C antigen-binding domain comprises an amino acid sequence at least 98% identical to an amino acid sequence according to any one of SEQ ID NOs: 53-62, and comprises CDR1, CDR2, and CDR3 sequences of SEQ ID NOs: 72-74, respectively. In some embodiments, the GUCY2C antigen-binding domain comprises an amino acid sequence at least 99% identical to an amino acid sequence according to any one of SEQ ID NOs: 53-62, and comprises CDR1, CDR2, and CDR3 sequences of SEQ ID NOs: 72-74, respectively.
[0114] In some embodiments, the GUCY2C antigen-binding domain comprises an amino acid sequence at least 80% identical to an amino acid sequence according to any one of SEQ ID NOs: 63-71, and comprises CDR1, CDR2, and CDR3 sequences of SEQ ID NOs: 75-77, respectively. In some embodiments, the GUCY2C antigen-binding domain comprises an amino acid sequence at least 85% identical to an amino acid sequence according to any one of SEQ ID NOs: 63-71, and comprises CDR1, CDR2, and CDR3 sequences of SEQ ID NOs: 75-77, respectively. In some embodiments, the GUCY2C antigen-binding domain comprises an amino acid sequence at least 90% identical to an amino acid sequence according to any one of SEQ ID NOs: 63-71, and comprises CDR1, CDR2, and CDR3 sequences of SEQ ID NOs: 75-77, respectively. In some embodiments, the GUCY2C antigen-binding domain comprises an amino acid sequence at least 95% identical to an amino acid sequence according to any one of SEQ ID NOs: 63-71, and comprises CDR1, CDR2, and CDR3 sequences of SEQ ID NOs: 75-77, respectively. In some embodiments, the GUCY2C antigen-binding domain comprises an amino acid sequence at least 96% identical to an amino acid sequence according to any one of SEQ ID NOs: 63-71, and comprises CDR1, CDR2, and CDR3 sequences of SEQ ID NOs: 75-77, respectively. In some embodiments, the GUCY2C antigen-binding domain comprises an amino acid sequence at least 97% identical to an amino acid sequence according to any one of SEQ ID NOs: 63-71, and comprises CDR1, CDR2, and CDR3 sequences of SEQ ID NOs: 75-77, respectively. In some embodiments, the GUCY2C antigen-binding domain comprises an amino acid sequence at least 98% identical to an amino acid sequence according to any one of SEQ ID NOs: 63-71, and comprises CDR1, CDR2, and CDR3 sequences of SEQ ID NOs: 75-77, respectively. In some embodiments, the GUCY2C antigen-binding domain comprises an amino acid sequence at least 99% identical to an amino acid sequence according to any one of SEQ ID NOs: 63-71, and comprises CDR1, CDR2, and CDR3 sequences of SEQ ID NOs: 75-77, respectively.
[0115] Amino acid sequences of exemplary GUCY2C antigen-binding domains are provided in Table 4.
| TABLE 4 | ||
|---|---|---|
| Table of Sequences | ||
| SEQ ID NO. | Description | Amino Acid/Nucleic Acid |
| SEQ ID NO: 53 | TI001-V20-H1 | Amino Acid |
| SEQ ID NO: 54 | TI001-V20-H2 | Amino Acid |
| SEQ ID NO: 55 | TI001-V20-H3 | Amino Acid |
| SEQ ID NO: 56 | TI001-V20-H4 | Amino Acid |
| SEQ ID NO: 57 | TI001-V20-H5 | Amino Acid |
| SEQ ID NO: 58 | TI001-V20-H6 | Amino Acid |
| SEQ ID NO: 59 | TI001-V20-H7 | Amino Acid |
| SEQ ID NO: 60 | TI001-V20-H8 | Amino Acid |
| SEQ ID NO: 61 | TI001-V20-H9 | Amino Acid |
| SEQ ID NO: 62 | TI001-V20-H10 | Amino Acid |
| SEQ ID NO: 63 | TI001-V54-H1 | Amino Acid |
| SEQ ID NO: 64 | TI001-V54-H2 | Amino Acid |
| SEQ ID NO: 65 | TI001-V54-H3 | Amino Acid |
| SEQ ID NO: 66 | TI001-V54-H4 | Amino Acid |
| SEQ ID NO: 67 | TI001-V54-H5 | Amino Acid |
| SEQ ID NO: 68 | TI001-V54-H6 | Amino Acid |
| SEQ ID NO: 69 | TI001-V54-H7 | Amino Acid |
| SEQ ID NO: 70 | TI001-V54-H8 | Amino Acid |
| SEQ ID NO: 71 | TI001-V54-H9 | Amino Acid |
[0116] In some embodiments, the GUCY2C antigen-binding domain is a nanobody and comprises (a) a VHH CDR1 having an amino acid selected from the group consisting of SEQ ID NO: 72 and 75; (b) a VHH CDR2 having an amino acid selected from the group consisting of SEQ ID NO: 73 and 76; and (c) a VHH CDR3 having an amino acid selected from the group consisting of SEQ ID NO: 74 and 77. In some embodiments, GUCY2C antigen-binding domain is a nanobody and comprises a CDR1 having the amino acid sequence of SEQ ID NO: 72, a CDR2 having the amino acid sequence of SEQ ID NO: 73, and a CDR2 having the amino acid sequence of SEQ ID NO: 74. In some embodiments, GUCY2C antigen-binding domain is a nanobody and comprises a CDR1 having the amino acid sequence of SEQ ID NO: 75, a CDR2 having the amino acid sequence of SEQ ID NO: 76, and a CDR2 having the amino acid sequence of SEQ ID NO: 77.
[0117] Amino acid sequences of exemplary GUCY2C antigen-binding domain CDRs are provided in Table 5.
| TABLE 5 | ||
|---|---|---|
| Table of Sequences | ||
| SEQ ID NO | Description | Amino Acid/Nucleic Acid |
| SEQ ID NO: 72 | TI001-V20 VHH CDR1 | Amino Acid |
| SEQ ID NO: 73 | TI001-V20 VHH CDR2 | Amino Acid |
| SEQ ID NO: 74 | TI001-V20 VHH CDR3 | Amino Acid |
| SEQ ID NO: 75 | TI001-V54 VHH CDRI | Amino Acid |
| SEQ ID NO: 76 | TI001-V54 VHH CDR2 | Amino Acid |
| SEQ ID NO: 77 | TI001-V54 VHH CDR3 | Amino Acid |
Specific TACs
[0118] Disclosed herein, in certain embodiments, are GUCY2C TAC proteins comprising an amino acid sequence with the amino acid sequence of any one of SEQ ID NOs: 79, 81, 83, 85, 87, 89, 91, 93, 95, 97, 99, 101, 103, 105, 107, 109, 111, 113, 115, 117, 119, 121, 123, 125, 127, 129, 131, 133, 135, 137, 139, 141, 143, 145, 147, 149, 151, and 153.
[0119] In some embodiments, the GUCY2C TAC protein comprises an amino acid sequence having at least 80% sequence identity with the amino acid sequence of any one of SEQ ID NOs: 79, 81, 83, 85, 87, 89, 91, 93, 95, 97, 99, 101, 103, 105, 107, 109, 111, 113, 115, 117, 119, 121, 123, 125, 127, 129, 131, 133, 135, 137, 139, 141, 143, 145, 147, 149, 151, and 153. In some embodiments, the GUCY2C TAC protein comprises an amino acid sequence having at least 85% sequence identity with the amino acid sequence of any one of SEQ ID NOs: 79, 81, 83, 85, 87, 89, 91, 93, 95, 97, 99, 101, 103, 105, 107, 109, 111, 113, 115, 117, 119, 121, 123, 125, 127, 129, 131, 133, 135, 137, 139, 141, 143, 145, 147, 149, 151, and 153. In some embodiments, the GUCY2C TAC protein comprises an amino acid sequence having at least 90% sequence identity with the amino acid sequence of any one of SEQ ID NOs: 79, 81, 83, 85, 87, 89, 91, 93, 95, 97, 99, 101, 103, 105, 107, 109, 111, 113, 115, 117, 119, 121, 123, 125, 127, 129, 131, 133, 135, 137, 139, 141, 143, 145, 147, 149, 151, and 153. In some embodiments, the GUCY2C TAC protein comprises an amino acid sequence having at least 95% sequence identity with the amino acid sequence of any one of SEQ ID NOs: 79, 81, 83, 85, 87, 89, 91, 93, 95, 97, 99, 101, 103, 105, 107, 109, 111, 113, 115, 117, 119, 121, 123, 125, 127, 129, 131, 133, 135, 137, 139, 141, 143, 145, 147, 149, 151, and 153. In some embodiments, the GUCY2C TAC protein comprises an amino acid sequence having at least 96% sequence identity with the amino acid sequence of any one of SEQ ID NOs: 79, 81, 83, 85, 87, 89, 91, 93, 95, 97, 99, 101, 103, 105, 107, 109, 111, 113, 115, 117, 119, 121, 123, 125, 127, 129, 131, 133, 135, 137, 139, 141, 143, 145, 147, 149, 151, and 153. In some embodiments, the GUCY2C TAC protein comprises an amino acid sequence having at least 97% sequence identity with the amino acid sequence of any one of SEQ ID NOs: 79, 81, 83, 85, 87, 89, 91, 93, 95, 97, 99, 101, 103, 105, 107, 109, 111, 113, 115, 117, 119, 121, 123, 125, 127, 129, 131, 133, 135, 137, 139, 141, 143, 145, 147, 149, 151, and 153. In some embodiments, the GUCY2C TAC protein comprises an amino acid sequence having at least 98% sequence identity with the amino acid sequence of any one of SEQ ID NOs: 79, 81, 83, 85, 87, 89, 91, 93, 95, 97, 99, 101, 103, 105, 107, 109, 111, 113, 115, 117, 119, 121, 123, 125, 127, 129, 131, 133, 135, 137, 139, 141, 143, 145, 147, 149, 151, and 153. In some embodiments, the GUCY2C TAC protein comprises an amino acid sequence having at least 99% sequence identity with the amino acid sequence of any one of SEQ ID NOs: 79, 81, 83, 85, 87, 89, 91, 93, 95, 97, 99, 101, 103, 105, 107, 109, 111, 113, 115, 117, 119, 121,123, 125, 127, 129, 131, 133, 135, 137, 139, 141, 143, 145, 147, 149, 151, and 153. In some embodiments, the GUCY2C TAC protein comprises an amino acid sequence of any one of SEQ ID NOs: 79, 81, 83, 85, 87, 89, 91, 93, 95, 97, 99, 101, 103, 105, 107, 109, 111, 113, 115, 117, 119, 121, 123, 125, 127, 129, 131, 133, 135, 137, 139, 141, 143, 145, 147, 149, 151, and 153.
[0120] In some embodiments, the GUCY2C TAC protein comprises an amino acid sequence having at least 80% sequence identity with the amino acid sequence of any one of SEQ ID NOs: 79, 81, 83, 85, 87, 89, 91, 93, 95, 97, 117, 119, 121, 123, 125, 127, 129, 131, 133, and 135 and comprises CDR1, CDR2, and CDR3 sequences of SEQ ID NOs: 75-77, respectively. In some embodiments, the GUCY2C TAC protein comprises an amino acid sequence having at least 85% sequence identity with the amino acid sequence of any one of SEQ ID NOs: 79, 81, 83, 85, 87, 89, 91, 93, 95, 97, 117, 119, 121, 123, 125, 127, 129, 131, 133, and 135 and comprises CDR1. CDR2, and CDR3 sequences of SEQ ID NOs: 75-77, respectively. In some embodiments, the GUCY2C TAC protein comprises an amino acid sequence having at least 90% sequence identity with the amino acid sequence of any one of SEQ ID NOs: 79, 81, 83, 85, 87, 89, 91, 93, 95, 97, 117, 119, 121, 123, 125, 127, 129, 131, 133, and 135 and comprises CDR1, CDR2, and CDR3 sequences of SEQ ID NOs: 75-77, respectively. In some embodiments, the GUCY2C TAC protein comprises an amino acid sequence having at least 95% sequence identity with the amino acid sequence of any one of SEQ ID NOs: 79, 81, 83, 85, 87, 89, 91, 93, 95, 97, 117, 119, 121, 123, 125, 127, 129, 131, 133, and 135 and comprises CDR1, CDR2, and CDR3 sequences of SEQ ID NOs: 75-77, respectively. In some embodiments, the GUCY2C TAC protein comprises an amino acid sequence having at least 96% sequence identity with the amino acid sequence of any one of SEQ ID NOs: 79, 81, 83, 85, 87, 89, 91, 93, 95, 97, 117, 119, 121, 123, 125, 127, 129, 131, 133, and 135 and comprises CDR1, CDR2, and CDR3 sequences of SEQ ID NOs: 75-77, respectively. In some embodiments, the GUCY2C TAC protein comprises an amino acid sequence having at least 97% sequence identity with the amino acid sequence of any one of SEQ ID NOs: 79, 81, 83, 85, 87, 89, 91, 93, 95, 97, 117, 119, 121, 123, 125, 127, 129, 131, 133, and 135 and comprises CDR1, CDR2, and CDR3 sequences of SEQ ID NOs: 75-77, respectively. In some embodiments, the GUCY2C TAC protein comprises an amino acid sequence having at least 98% sequence identity with the amino acid sequence of any one of SEQ ID NOs: 79, 81, 83, 85, 87, 89, 91, 93, 95, 97, 117, 119, 121, 123, 125, 127, 129, 131, 133, and 135 and comprises CDR1, CDR2, and CDR3 sequences of SEQ ID NOs: 75-77, respectively. In some embodiments, the GUCY2C TAC protein comprises an amino acid sequence having at least 99% sequence identity with the amino acid sequence of any one of SEQ ID NOs: 79, 81, 83, 85, 87, 89, 91, 93, 95, 97, 117, 119, 121, 123, 125, 127, 129, 131, 133, and 135 and comprises CDR1, CDR2, and CDR3 sequences of SEQ ID NOs: 75-77, respectively. In some embodiments, the GUCY2C TAC protein comprises an amino acid sequence of any one of SEQ ID NOs: 79, 81, 83, 85, 87, 89, 91, 93, 95, 97, 117, 119, 121, 123, 125, 127, 129, 131, 133, and 135 and comprises CDR1, CDR2, and CDR3 sequences of SEQ ID NOs: 75-77, respectively.
[0121] In some embodiments, the GUCY2C TAC protein comprises an amino acid sequence having at least 80% sequence identity with the amino acid sequence of any one of SEQ ID NOs: 99, 101, 103, 105, 107, 109, 111, 113, 115, 137, 139, 141, 143, 145, 147, 149, 151, and 153 and comprises CDR1, CDR2, and CDR3 sequences of SEQ ID NOs: 75-77, respectively. In some embodiments, the GUCY2C TAC protein comprises an amino acid sequence having at least 85% sequence identity with the amino acid sequence of any one of SEQ ID NOs: 99, 101, 103, 105, 107, 109, 111, 113, 115, 137, 139, 141, 143, 145, 147, 149, 151, and 153 and comprises CDR1, CDR2, and CDR3 sequences of SEQ ID NOs: 75-77, respectively. In some embodiments, the GUCY2C TAC protein comprises an amino acid sequence having at least 90% sequence identity with the amino acid sequence of any one of SEQ ID NOs: 99, 101, 103, 105, 107, 109, 111, 113, 115, 137, 139, 141, 143, 145, 147, 149, 151, and 153 and comprises CDR1, CDR2, and CDR3 sequences of SEQ ID NOs: 75-77, respectively. In some embodiments, the GUCY2C TAC protein comprises an amino acid sequence having at least 95% sequence identity with the amino acid sequence of any one of SEQ ID NOs: 99, 101, 103, 105, 107, 109, 111, 113, 115, 137, 139, 141, 143, 145, 147, 149, 151, and 153 and comprises CDR1. CDR2, and CDR3 sequences of SEQ ID NOs: 75-77, respectively. In some embodiments, the GUCY2C TAC protein comprises an amino acid sequence having at least 96% sequence identity with the amino acid sequence of any one of SEQ ID NOs: 99, 101, 103, 105, 107, 109, 111, 113, 115, 137, 139, 141, 143, 145, 147, 149, 151, and 153 and comprises CDR1, CDR2, and CDR3 sequences of SEQ ID NOs: 75-77, respectively. In some embodiments, the GUCY2C TAC protein comprises an amino acid sequence having at least 97% sequence identity with the amino acid sequence of any one of SEQ ID NOs: 99, 101, 103, 105, 107, 109, 111, 113, 115, 137, 139, 141, 143, 145, 147, 149, 151, and 153 and comprises CDR1, CDR2, and CDR3 sequences of SEQ ID NOs: 75-77, respectively. In some embodiments, the GUCY2C TAC protein comprises an amino acid sequence having at least 98% sequence identity with the amino acid sequence of any one of SEQ ID NOs: 99, 101, 103, 105, 107, 109, 111, 113, 115, 137, 139, 141, 143, 145, 147, 149, 151, and 153 and comprises CDR1. CDR2, and CDR3 sequences of SEQ ID NOs: 75-77, respectively. In some embodiments, the GUCY2C TAC protein comprises an amino acid sequence having at least 99% sequence identity with the amino acid sequence of any one of SEQ ID NOs: 99, 101, 103, 105, 107, 109, 111, 113, 115, 137, 139, 141, 143, 145, 147, 149, 151, and 153 and comprises CDR1, CDR2, and CDR3 sequences of SEQ ID NOs: 75-77, respectively. In some embodiments, the GUCY2C TAC protein comprises an amino acid sequence of any one of SEQ ID NOs: 99, 101, 103, 105, 107, 109, 111, 113, 115, 137, 139, 141, 143, 145, 147, 149, 151, and 153 and comprises CDR1, CDR2, and CDR3 sequences of SEQ ID NOs: 75-77, respectively.
[0122] In some embodiments, the GUCY2C TAC protein is encoded by a nucleic acid sequence having at least 80% sequence identity with the nucleic acid sequence of any one of SEQ ID NOs: 78, 80, 82, 84, 86, 88, 90, 92, 94, 96, 98, 100, 102, 104, 106, 108, 110, 112, 114, 116, 118, 120, 122, 124, 126, 128, 130, 132, 134, 136, 138, 140, 142, 144, 146, 148, 150, and 152. In some embodiments, the GUCY2C TAC protein is encoded by a nucleic acid sequence having at least 85% sequence identity with the nucleic acid sequence of any one of SEQ ID NOs: 78, 80, 82, 84, 86, 88, 90, 92, 94, 96, 98, 100, 102, 104, 106, 108, 110, 112, 114,116, 118, 120, 122, 124, 126, 128, 130, 132, 134, 136, 138, 140, 142, 144, 146, 148, 150, and 152. In some embodiments, the GUCY2C TAC protein is encoded by a nucleic acid sequence having at least 90% sequence identity with the nucleic acid sequence of any one of SEQ ID NOs: 78, 80, 82, 84, 86, 88, 90, 92, 94, 96, 98, 100, 102, 104, 106, 108, 110, 112, 114, 116, 118, 120, 122, 124, 126, 128, 130, 132, 134, 136, 138, 140, 142, 144, 146, 148, 150, and 152. In some embodiments, the GUCY2C TAC protein is encoded by a nucleic acid sequence having at least 95% sequence identity with the nucleic acid sequence of any one of SEQ ID NOs: 78, 80, 82, 84, 86, 88, 90, 92, 94, 96, 98, 100, 102, 104, 106, 108, 110, 112, 114, 116, 118, 120, 122, 124, 126, 128, 130, 132, 134, 136, 138, 140, 142, 144, 146, 148, 150, and 152. In some embodiments, the GUCY2C TAC protein is encoded by a nucleic acid sequence having at least 96% sequence identity with the nucleic acid sequence of any one of SEQ ID NOs: 78, 80, 82, 84, 86, 88, 90, 92, 94, 96, 98, 100, 102, 104, 106, 108, 110, 112, 114, 116, 118, 120, 122, 124, 126, 128, 130, 132, 134, 136, 138, 140, 142, 144, 146, 148, 150, and 152. In some embodiments, the GUCY2C TAC protein is encoded by a nucleic acid sequence having at least 97% sequence identity with the nucleic acid sequence of any one of SEQ ID NOs: 78, 80, 82, 84, 86, 88, 90, 92, 94, 96, 98, 100, 102, 104, 106, 108, 110, 112, 114, 116, 118, 120, 122, 124, 126, 128, 130, 132, 134, 136, 138, 140, 142, 144, 146, 148, 150, and 152. In some embodiments, the GUCY2C TAC protein is encoded by a nucleic acid sequence having at least 98% sequence identity with the nucleic acid sequence of any one of SEQ ID NOs: 78, 80, 82, 84, 86, 88, 90, 92, 94, 96, 98, 100, 102, 104, 106, 108, 110, 112, 114, 116, 118, 120, 122, 124, 126, 128, 130, 132, 134, 136, 138, 140, 142, 144, 146, 148, 150, and 152. In some embodiments, the GUCY2C TAC protein is encoded by a nucleic acid sequence having at least 99% sequence identity with the nucleic acid sequence of any one of SEQ ID NOs: 78, 80, 82, 84, 86, 88, 90, 92, 94, 96, 98, 100, 102, 104, 106, 108, 110, 112, 114, 116, 118, 120, 122, 124, 126, 128, 130, 132, 134, 136, 138, 140, 142, 144, 146, 148, 150, and 152. In some embodiments, the GUCY2C TAC protein is encoded by a nucleic acid sequence of any one of SEQ ID NOs: 78, 80, 82, 84, 86, 88, 90, 92, 94, 96, 98, 100, 102, 104, 106, 108, 110, 112, 114, 116, 118, 120, 122, 124, 126, 128, 130, 132, 134, 136, 138, 140, 142, 144, 146, 148, 150, and 152.
[0123] Amino acid sequences and nucleic acid sequences of exemplary GUCY2C TACs are provided in Table 6.
| TABLE 6 | ||
|---|---|---|
| Table of Sequences | ||
| Amino | ||
| Acid/Nucleic | ||
| SEQ ID NO. | Description | Acid |
| SEQ ID NO: 78 | TI001-V20-H1-TAC | Nucleotide |
| SEQ ID NO: 79 | TI001-V20-H1-TAC | Amino Acid |
| SEQ ID NO: 80 | TI001-V20-H2-TAC | Nucleotide |
| SEQ ID NO: 81 | TI001-V20-H2-TAC | Amino Acid |
| SEQ ID NO: 82 | TI001-V20-H3-TAC | Nucleotide |
| SEQ ID NO: 83 | TI001-V20-H3-TAC | Amino Acid |
| SEQ ID NO: 84 | TI001-V20-H4-TAC | Nucleotide |
| SEQ ID NO: 85 | TI001-V20-H4-TAC | Amino Acid |
| SEQ ID NO: 86 | TI001-V20-H5 TAC | Nucleotide |
| SEQ ID NO: 87 | TI001-V20-H5 TAC | Amino Acid |
| SEQ ID NO: 88 | TI001-V20-H6-TAC | Nucleotide |
| SEQ ID NO: 89 | TI001-V20-H6-TAC | Amino Acid |
| SEQ ID NO: 90 | TI001-V20-H7-TAC | Nucleotide |
| SEQ ID NO: 91 | TI001-V20-H7-TAC | Amino Acid |
| SEQ ID NO: 92 | TI001-V20-H8-TAC | Nucleotide |
| SEQ ID NO: 93 | TI001-V20-H8-TAC | Amino Acid |
| SEQ ID NO: 94 | TI001-V20-H9-TAC | Nucleotide |
| SEQ ID NO: 95 | TI001-V20-H9-TAC | Amino Acid |
| SEQ ID NO: 96 | TI001-V20-H10-TAC | Nucleotide |
| SEQ ID NO: 97 | TI001-V20-H10-TAC | Amino Acid |
| SEQ ID NO: 98 | TI001-V54-H1-TAC | Nucleotide |
| SEQ ID NO: 99 | TI001-V54-H1-TAC | Amino Acid |
| SEQ ID NO: 100 | TI001-V54-H2-TAC | Nucleotide |
| SEQ ID NO: 101 | TI001-V54-H2-TAC | Amino Acid |
| SEQ ID NO: 102 | TI001-V54-H3-TAC | Nucleotide |
| SEQ ID NO: 103 | TI001-V54-H3-TAC | Amino Acid |
| SEQ ID NO: 104 | TI001-V54-H4-TAC | Nucleotide |
| SEQ ID NO: 105 | TI001-V54-H4-TAC | Amino Acid |
| SEQ ID NO: 106 | TI001-V54-H5-TAC | Nucleotide |
| SEQ ID NO: 107 | TI001-V54-H5-TAC | Amino Acid |
| SEQ ID NO: 108 | TI001-V54-H6-TAC | Nucleotide |
| SEQ ID NO: 109 | TI001-V54-H6-TAC | Amino Acid |
| SEQ ID NO: 110 | TI001-V54-H7-TAC | Nucleotide |
| SEQ ID NO: 111 | TI001-V54-H7-TAC | Amino Acid |
| SEQ ID NO: 112 | TI001-V54-H8-TAC | Nucleotide |
| SEQ ID NO: 113 | TI001-V54-H8-TAC | Amino Acid |
| SEQ ID NO: 114 | TI001-V54-H9-TAC | Nucleotide |
| SEQ ID NO: 115 | TI001-V54-H9-TAC | Amino Acid |
| SEQ ID NO: 116 | TI001-V20-H1-TAC(Y177T) | Nucleotide |
| SEQ ID NO: 117 | TI001-V20-H1-TAC(Y177T) | Amino Acid |
| SEQ ID NO: 118 | TI001-V20-H2-TAC(Y177T) | Nucleotide |
| SEQ ID NO: 119 | TI001-V20-H2-TAC(Y177T) | Amino Acid |
| SEQ ID NO: 120 | TI001-V20-H3-TAC(Y177T) | Nucleotide |
| SEQ ID NO: 121 | TI001-V20-H3-TAC(Y177T) | Amino Acid |
| SEQ ID NO: 122 | TI001-V20-H4-TAC(Y177T) | Nucleotide |
| SEQ ID NO: 123 | TI001-V20-H4-TAC(Y177T) | Amino Acid |
| SEQ ID NO: 124 | TI001-V20-H5-TAC(Y177T) | Nucleotide |
| SEQ ID NO: 125 | TI001-V20-H5-TAC(Y177T) | Amino Acid |
| SEQ ID NO: 126 | TI001-V20-H6-TAC(Y177T) | Nucleotide |
| SEQ ID NO: 127 | TI001-V20-H6-TAC(Y177T) | Amino Acid |
| SEQ ID NO: 128 | TI001-V20-H7-TAC(Y177T) | Nucleotide |
| SEQ ID NO: 129 | TI001-V20-H7-TAC(Y177T) | Amino Acid |
| SEQ ID NO: 130 | TI001-V20-H8-TAC(Y177T) | Nucleotide |
| SEQ ID NO: 131 | TI001-V20-H8-TAC(Y177T) | Amino Acid |
| SEQ ID NO: 132 | TI001-V20-H9-TAC(Y177T) | Nucleotide |
| SEQ ID NO: 133 | TI001-V20-H9-TAC(Y177T) | Amino Acid |
| SEQ ID NO: 134 | TI001-V20-H10-TAC(Y177T) | Nucleotide |
| SEQ ID NO: 135 | TI001-V20-H10-TAC(Y177T) | Amino Acid |
| SEQ ID NO: 136 | TI001-V54-H1-TAC(Y177T) | Nucleotide |
| SEQ ID NO: 137 | TI001-V54-H1-TAC(Y177T) | Amino Acid |
| SEQ ID NO: 138 | TI001-V54-H2-TAC(Y177T) | Nucleotide |
| SEQ ID NO: 139 | TI001-V54-H2-TAC(Y177T) | Amino Acid |
| SEQ ID NO: 140 | TI001-V54-H3-TAC(Y177T) | Nucleotide |
| SEQ ID NO: 141 | TI001-V54-H3-TAC(Y177T) | Amino Acid |
| SEQ ID NO: 142 | TI001-V54-H4-TAC(Y177T) | Nucleotide |
| SEQ ID NO: 143 | TI001-V54-H4-TAC(Y177T) | Amino Acid |
| SEQ ID NO: 144 | TI001-V54-H5-TAC(Y177T) | Nucleotide |
| SEQ ID NO: 145 | TI001-V54-H5-TAC(Y177T) | Amino Acid |
| SEQ ID NO: 146 | TI001-V54-H6-TAC(Y177T) | Nucleotide |
| SEQ ID NO: 147 | TI001-V54-H6-TAC(Y177T) | Amino Acid |
| SEQ ID NO: 148 | TI001-V54-H7-TAC(Y177T) | Nucleotide |
| SEQ ID NO: 149 | TI001-V54-H7-TAC(Y177T) | Amino Acid |
| SEQ ID NO: 150 | TI001-V54-H8-TAC(Y177T) | Nucleotide |
| SEQ ID NO: 151 | TI001-V54-H8-TAC(Y177T) | Amino Acid |
| SEQ ID NO: 152 | TI001-V54-H9-TAC(Y177T) | Nucleotide |
| SEQ ID NO: 153 | TI001-V54-H9-TAC(Y177T) | Amino Acid |
Vector Constructs
[0124] Disclosed herein, in certain embodiments, are vectors comprising a GUCY2C TAC nucleic acid sequence as disclosed herein. In some embodiments, the vectors further comprise a promoter. In some embodiments, the promoter is functional in a mammalian cell. Promoters, regions of DNA that initiate transcription of a particular nucleic acid sequence, are well known in the art. A “promoter functional in a mammalian cell” refers to a promoter that drives expression of the associated nucleic acid sequence in a mammalian cell. A promoter that drives expression of a nucleic acid sequence is referred to as being “operably connected” to the nucleic acid sequence.
[0125] A variety of delivery vectors and expression vehicles are employed to introduce nucleic acids described herein into a cell.
[0126] Disclosed herein, in certain embodiments, are vectors comprising:
-
- [0127] (a) a first polynucleotide encoding an antigen-binding domain that binds GUCY2C;
- [0128] (b) a second polynucleotide encoding an antigen-binding domain that binds a protein associated with a TCR complex;
- [0129] (c) a third polynucleotide encoding a T cell receptor signaling domain polypeptide; and
- [0130] (d) a promoter that is functional in a mammalian cell.
[0131] In some embodiments, the first polynucleotide and third polynucleotide are fused to the second polynucleotide and the coding sequence is operably connected to the promoter. In some embodiments, the second polynucleotide and third polynucleotide are fused to the first polynucleotide and the coding sequence is operably connected to the promoter. In some embodiments, the vector is designed for expression in mammalian cells. In some embodiments, the vector is a viral vector. In some embodiments, the viral vector is a retroviral vector.
[0132] In some embodiments, vectors that are useful comprise vectors derived from retroviruses, lentiviruses, Murine Stem Cell Viruses (MSCV), pox viruses, adenoviruses, and adeno-associated viruses. Other delivery vectors that are useful comprise vectors derived from herpes simplex viruses, transposons, vaccinia viruses, human papilloma virus, Simian immunodeficiency viruses, HTLV, human foamy virus and variants thereof. Further vectors that are useful comprise vectors derived from spumaviruses, mammalian type B retroviruses, mammalian type C retroviruses, avian type C retroviruses, mammalian type D retroviruses and HTLV/BLV type retroviruses. One example of a lentiviral vector useful in the disclosed compositions and methods is the pCCL4 vector.
Pharmaceutical Compositions
[0133] Disclosed herein, in certain embodiments, are pharmaceutical compositions comprising an engineered T cell disclosed herein (transduced with and/or expressing a GUCY2C TAC polypeptide), and a pharmaceutically acceptable carrier. Pharmaceutically acceptable carriers include, but are not limited to, buffers such as neutral buffered saline, phosphate buffered saline and the like; carbohydrates such as glucose, mannose, sucrose or dextrans, mannitol; proteins; polypeptides or amino acids such as glycine; antioxidants; chelating agents such as EDTA or glutathione: adjuvants (e.g., aluminum hydroxide); or preservatives. In some embodiments, the engineered T cells are formulated for intravenous administration.
[0134] Pharmaceutical compositions are administered in a manner appropriate to the disease to be treated (or prevented). The quantity and frequency of administration is determined by such factors as the condition of the patient, and the type and severity of the patient's disease, although appropriate dosages are determined by clinical trials. When “an immunologically effective amount,” “an anti-tumor effective amount,” “a tumor-inhibiting effective amount,” or “therapeutic amount” is indicated, the precise amount of the compositions of the present invention to be administered is determined by a physician with consideration of individual differences in age, weight, tumor size, extent of infection or metastasis, and condition of the patient (subject).
[0135] In some embodiments, the engineered T cells and/or pharmaceutical compositions described herein are administered at a dosage of 101 to 1015 cells per kg body weight, 104 to 109 cells per kg body weight, optionally 105 to 108 cells per kg body weight, 106 to 107 cells per kg body weight or 105 to 106 cells per kg body weight, including all integer values within those ranges. In some embodiments, the modified T cells and/or pharmaceutical compositions described herein are administered at a dosage of greater than 101 cells per kg body weight. In some embodiments, the modified T cells and/or pharmaceutical compositions described herein are administered at a dosage of less than 1015 cells per kg body weight.
[0136] In some embodiments, the engineered T cells and/or pharmaceutical compositions described herein are administered at a dosage of 0.5×106 cells, 2×106 cells, 4×106 cells, 5×106 cells. 1.2×107 cells, 2×107 cells, 5×107 cells, 2×108 cells, 5×108 cells. 2×109 cells, 0.5-2000×106 cells, 0.5-2×106 cells, 0.5-2×107 cells, 0.5-2×108 cells, or 0.5-2×109 cells, including all integer values within those ranges.
[0137] Also disclosed herein are pharmaceutical compositions comprising engineered/modified and unmodified T cells, or comprising different populations of engineered/modified T cells with or without unmodified T cells. One of ordinary skill in the art would understand that a therapeutic quantity of engineered/modified T cells need not be homogenous in nature. In some embodiments, engineered/modified T cells, when activated, are capable of activating unmodified T cells within the same pharmaceutical composition/cell population. In some embodiments, engineered/modified T cells are capable of activating unmodified T cells only when activated in response to binding of the antigen to the TAC expressed by the engineered/modified T cell (e.g., GUCY2C).
[0138] In some embodiments, T cell compositions are administered multiple times at these dosages. In some embodiments, the dosage is administered a single time or multiple times, for example daily, weekly, biweekly, or monthly, hourly, or is administered upon recurrence, relapse or progression of the cancer being treated. The cells, in some embodiments, are administered by using infusion techniques that are commonly known in immunotherapy (see, e.g., Rosenberg et al., New Eng. J. of Med. 319:1676, 1988).
[0139] In some embodiments, the pharmaceutical composition is substantially free of, e.g., there are no detectable levels of a contaminant, e.g., selected from the group consisting of endotoxin, mycoplasma, replication competent lentivirus (RCL), p24, VSV-G nucleic acid, HIV gag, residual anti-CD3/anti-CD28 coated beads, mouse antibodies, pooled human serum, bovine serum albumin, bovine serum, culture media components, vector packaging cell or plasmid components, a bacterium a fungus, mycoplasma, IL-2, and IL-7.
[0140] In some embodiments, the modified/engineered T cells and/or pharmaceutical compositions are administered by methods including, but not limited to, aerosol inhalation, injection, infusion, ingestion, transfusion, implantation or transplantation. The modified T cells and/or pharmaceutical compositions may be administered to a subject transarterially, subcutaneously, intradermally, intratumorally, intranodally, intrameduliary, intramuscularly, by intravenous (i.v.) injection, by intravenous (i.v.) infusion, or intraperitoneally. The modified/engineered T cells and/or pharmaceutical compositions thereof may be administered to a patient by intradermal or subcutaneous injection. The modified/engineered T cells and/or pharmaceutical compositions thereof may be administered by i.v. injection. The modified/engineered T cells and/or pharmaceutical compositions thereof may be injected directly into a tumor, lymph node, or site of infection.
[0141] A pharmaceutical composition may be prepared by known methods for the preparation of pharmaceutically acceptable compositions that are administered to subjects, such that an effective quantity of the T cells is combined in a mixture with a pharmaceutically acceptable carrier. Suitable carriers are described, for example, in Remington's Pharmaceutical Sciences (Remington's Pharmaceutical Sciences, 20th ed., Mack Publishing Company, Easton, Pa., USA, 2000). On this basis, the compositions may include, albeit not exclusively, solutions of the substances in association with one or more pharmaceutically acceptable carriers or diluents, and contained in buffered solutions with a suitable pH and iso-osmotic with the physiological fluids.
[0142] Suitable pharmaceutically acceptable carriers include essentially chemically inert and nontoxic compositions that do not interfere with the effectiveness of the biological activity of the pharmaceutical composition. Examples of suitable pharmaceutical carriers include, but are not limited to, water, saline solutions, glycerol solutions. N-(1(2,3-dioleyloxy)propyl)N,N,N-trimethylammonium chloride (DOTMA), diolesylphosphotidyl-ethanolamine (DOPE), and liposomes. In some embodiments, such compositions contain a therapeutically effective amount of the compound, together with a suitable amount of carrier so as to provide the form for direct administration to the patient.
[0143] Pharmaceutical compositions include, without limitation, lyophilized powders or aqueous or non-aqueous sterile injectable solutions or suspensions, which may further contain antioxidants, buffers, bacteriostats and solutes that render the compositions substantially compatible with the tissues or the blood of an intended recipient. Other components that may be present in such compositions include water, surfactants (such as Tween), alcohols, polyols, glycerin and vegetable oils, for example. Extemporaneous injection solutions and suspensions may be prepared from sterile powders, granules, tablets, or concentrated solutions or suspensions.
[0144] A pharmaceutical composition disclosed herein may be formulated into a variety of forms and administered by a number of different means. A pharmaceutical formulation may be administered orally, rectally, or parenterally, in formulations containing conventionally acceptable carriers, adjuvants, and vehicles as desired. The term “parenteral” as used herein includes subcutaneous, intravenous, intramuscular, or intrasternal injection and infusion techniques. Administration includes injection or infusion, including intra-arterial, intracardiac, intracerebroventricular, intradermal, intraduodenal, intramedullary, intramuscular, intraosseous, intraperitoneal, intrathecal, intravascular, intravenous, intravitreal, epidural and subcutaneous), inhalational, transdermal, transmucosal, sublingual, buccal and topical (including epicutaneous, dermal, enema, eye drops, ear drops, intranasal, vaginal) administration. In some exemplary embodiments, a route of administration is via an injection such as an intramuscular, intravenous, subcutaneous, or intraperitoneal injection.
[0145] Liquid formulations include an oral formulation, an intravenous formulation, an intranasal formulation, an ocular formulation, an otic formulation, an aerosol, and the like. In certain embodiments, a combination of various formulations is administered. In certain embodiments a composition is formulated for an extended release profile.
Methods of Treatment and Use
[0146] Disclosed herein, in certain embodiments, are methods of using engineered T cells disclosed herein in the treatment of a GUCY2C-expressing cancer in an individual in need thereof.
[0147] In some embodiments, an antigen-binding domain that binds GUCY2C of a TAC polypeptide disclosed herein binds to GUCY2C on a tumor cell. In some embodiments, an antigen-binding domain that binds GUCY2C of a TAC polypeptide disclosed herein selectively binds to GUCY2C on a tumor cell.
[0148] Disclosed herein, in certain embodiments, are methods of treating a cancer expressing GUCY2C in an individual in need thereof, comprising administering to the individual an engineered T cell disclosed herein or a pharmaceutical composition comprising an engineered T cell disclosed herein.
[0149] Further disclosed herein is use of an engineered T cell disclosed herein in the preparation of a medicament to treat cancer expressing GUCY2C in an individual in need thereof. Additionally disclosed herein in certain embodiments is the use of an engineered T cell disclosed herein or a pharmaceutical composition disclosed herein to treat a cancer expressing GUCY2C in an individual in need thereof.
[0150] In some embodiments, the engineered T cells disclosed herein are part of a combination therapy. In some embodiments, effectiveness of a therapy disclosed herein is assessed multiple times. In some embodiments, patients are stratified based on a response to a treatment disclosed herein. In some embodiments, an effectiveness of treatment determines entrance into a trial.
[0151] In some embodiments, the engineered T cells disclosed herein are administered in combination with a lymphodepleting therapy, or are administered to a subject who has received a lymphodepleting therapy. Examples of lymphodepleting therapies include nonmyeloablative lymphodepleting chemotherapy, myeloablative lymphodepleting chemotherapy, fludarabine, cyclophosphamide, corticosteroids, alemtuzumab, total body irradiation (TBI), and any combination thereof.
[0152] Cancers that may be treated with engineered T cells disclosed herein include any form of neoplastic disease. In some embodiments, the cancer is a colorectal cancer, a gastric cancer, a gastroesophageal junction cancer, an esophageal cancer, or a pancreatic cancer. In some embodiments, the cancer is a primary cancer. In some embodiments, the cancer is a metastatic cancer.
[0153] In some embodiments, the cancer is a primary colorectal cancer, a primary gastric cancer, a primary gastroesophageal junction cancer, a primary esophageal cancer, or a primary pancreatic cancer. In some embodiments, the cancer is a metastatic colorectal cancer, a metastatic gastric cancer, a metastatic gastroesophageal junction cancer, a metastatic esophageal cancer, or a metastatic pancreatic cancer. In some embodiments, the colorectal cancer is colorectal adenocarcinoma. In some embodiments, the colorectal cancer is cecum adenocarcinoma. In some embodiments, the gastric cancer is gastric adenocarcinoma (e.g., gastric tubular adenocarcinoma). In some embodiments, the cancer is leukemia.
[0154] In some embodiments, the cancer that is to be treated is a primary colorectal cancer. Colorectal cancer affects both men and women, and is responsible for 9.2% of all cancer deaths. The lack of response to targeted therapy, such as anti-EGFR antibodies, has been correlated with mutations in the KRAS and BRAF oncogenes. In addition, immunotherapies, such as immune checkpoint inhibitors, have failed to show significant survival benefit in most patients with colorectal cancer, owing to low tumor mutational burden and reduced density of immune infiltration. Guanylyl Cyclase C (GUCY2C) is overexpressed in more than 90% of colorectal cancers across all stages.
[0155] In some embodiments, the cancer that is to be treated is a primary gastric cancer, for example a primary gastroesophageal junction cancer or gastric tubular adenocarcinoma. Gastric cancers are the 6th most common cancer in the world, and the second-leading cause of cancer-related deaths worldwide. In most of the world, stomach cancers form in the main part of the stomach (stomach body). In the United States, stomach cancer is more likely to affect the area where the esophagus meets the stomach, i.e., gastroesophageal junction cancer. Many gastric cancers evolve from intestinal metaplasia resulting in over 50% of gastric cancers and gastroesophageal junction cancers being characterized by ectopic over-expression of GUCY2C.
[0156] In some embodiments, the cancer that is to be treated is a primary pancreatic cancer. Pancreatic cancer has the highest mortality rate of all major cancers. For all stages combined, the 5-year relative survival rate is 10%. For people diagnosed with local disease, the 5-year survival is only 39%. Many pancreatic cancers evolve from intestinal metaplasia resulting in over 50% of pancreatic cancers being characterized by overexpression of GUCY2C.
EXAMPLES
[0157] The following examples are given for the purpose of illustrating various embodiments of the invention and are not meant to limit the present invention in any fashion. The present examples, along with the methods described herein are presently representative of preferred embodiments, are exemplary, and are not intended as limitations on the scope of the invention. Changes therein and other uses which are encompassed within the spirit of the invention as defined by the scope of the claims will occur to those skilled in the art.
Example 1: Manufacturing of TAC T Cells Targeting GUCY2C Using Different Binder Variants
[0158] T cells were engineered using lentiviral vectors to express various GUCY2C-TAC receptors. The TAC receptors comprise the TAC scaffold (myc-tagged extracellular CD3-binding domain fused to the CD4 transmembrane and cytoplasmic domains) combined with different anti-GUCY2C single domain antibodies (nanobodies). GUCY2C-TAC variants using these different nanobodies are listed in Table 7. They include the parental G22 nanobody, as well as humanized variants of both the G22 (G22H1-G22H10) and G23 (G23H1-G23H9) nanobodies.
| TABLE 7 | |||
|---|---|---|---|
| Table of Nanobody Sequences | |||
| TAC ID | Binding Domain | Sequence ID | Short Name |
| TI001-V20-TAC(Y177T) | Nanobody | SEQ ID NO: 155 | G22 |
| TI001-V20-H1-TAC(Y177T) | Nanobody | SEQ ID NO: 117 | G22H1 |
| TI001-V20-H2-TAC(Y177T) | Nanobody | SEQ ID NO: 119 | G22H2 |
| TI001-V20-H3-TAC(Y177T) | Nanobody | SEQ ID NO: 121 | G22H3 |
| TI001-V20-H4-TAC(Y177T) | Nanobody | SEQ ID NO: 123 | G22H4 |
| TI001-V20-H5-TAC(Y177T) | Nanobody | SEQ ID NO: 125 | G22H5 |
| TI001-V20-H6-TAC(Y177T) | Nanobody | SEQ ID NO: 127 | G22H6 |
| TI001-V20-H7-TAC(Y177T) | Nanobody | SEQ ID NO: 129 | G22H7 |
| TI001-V20-H8-TAC(Y177T) | Nanobody | SEQ ID NO: 131 | G22H8 |
| TI001-V20-H9-TAC(Y177T) | Nanobody | SEQ ID NO: 133 | G22H9 |
| TI001-V20-H10-TAC(Y177T) | Nanobody | SEQ ID NO: 135 | G22H10 |
| TI001-V54-H1-TAC(Y177T) | Nanobody | SEQ ID NO: 137 | G23H1 |
| TI001-V54-H2-TAC(Y177T) | Nanobody | SEQ ID NO: 139 | G23H2 |
| TI001-V54-H3-TAC(Y177T) | Nanobody | SEQ ID NO: 141 | G23H3 |
| TI001-V54-H4-TAC(Y177T) | Nanobody | SEQ ID NO: 143 | G23H4 |
| TI001-V54-H5-TAC(Y177T) | Nanobody | SEQ ID NO: 145 | G23H5 |
| TI001-V54-H6-TAC(Y177T) | Nanobody | SEQ ID NO: 147 | G23H6 |
| TI001-V54-H7-TAC(Y177T) | Nanobody | SEQ ID NO: 149 | G23H7 |
| TI001-V54-H8-TAC(Y177T) | Nanobody | SEQ ID NO: 151 | G23H8 |
| TI001-V54-H9-TAC(Y177T) | Nanobody | SEQ ID NO: 153 | G23H9 |
Example 2: Phenotype of GUCY2C-TAC T Cells
[0159] GUCY2C-TAC T cells, using TAC receptors with both non-humanized and humanized anti-GUCY2C nanobodies listed in Table 7, were manufactured and phenotyped using flow cytometry. Cells were stained for TAC expression by targeting the Myc-Tag within the TAC receptor (FIG. 1A ). Dual staining of anti-myc together with the transduction marker mStrawberry (mStraw) is shown, demonstrating a transduction efficiency ranging from 34% to 74%. TAC surface expression was quantified by measuring the median fluorescence intensity (MFI) of TAC positive T cells (FIG. 1B ). The data indicate that all the selected GUCY2C-TAC receptors were successfully transduced into and expressed on the surface of T cells. Surface expression of TAC constructs with humanized nanobodies is equivalent or superior to the TAC receptor with the parental G22 nanobody.
Example 3: In Vitro Cytotoxicity of GUCY2C-TAC T Cells
[0160] A subset of T cells was engineered to express non-humanized and humanized GUCY2C-TAC receptors as listed in Table 7. GUCY2C-TAC T cells were co-cultured at E:T ratios of 1:5, 1:7.5 and 1:10 with 1×104 NALM6GUCY2C/eGFP target cells/well and monitored by a live-cell imaging reader. Images were captured every 8 hours for 5 consecutive days. Tumor cells express GFP, which indicates their presence, and the observed GFP surface area was calculated for each time point and plotted against time (FIG. 2 ). The data show that T cells engineered with GUCY2C-TAC variants G22, G22H1, G22H5, G22H8, and G23H4, but not G23H9 were able to kill target cells. The cytotoxicity of TAC constructs with humanized nanobodies, with the exception of G23H4 and G23H9, is equivalent to the TAC receptor featuring the parental G22 nanobody.
Example 4: In Vitro Expansion of GUCY2C-TAC T Cells
[0161] T cells engineered with various non-humanized and humanized GUCY2C-TAC receptors as included in Table 7 were tested for their proliferative potential in response to antigen stimulation. To this end, GUCY2C-TAC T cells were co-cultured in a 1:3 E:T ratio with either NALM6GUCY2C or N87GUCY2C target cells (FIG. 3 ). NALM6GUCY2C is a leukemic cell line that is engineered to overexpress GUCY2C, and naturally expresses CD19. N87GUCY2C is a gastric carcinoma cell line that is engineered to overexpress GUCY2C, and naturally expresses HER2. GUCY2C-TAC T cells were evaluated via the CTV (cell trace violet) proliferation assay described briefly as follows. Target cells were first inactivated using mitomycin C, then co-cultured with T cells pre-loaded with CTV dye. After a 4-day co-culture, T cells were analyzed via flow cytometry. As cells proliferate, they lose CTV expression which can be converted to a division index, which is calculated using FCS Express software and normalized by subtracting the T cell only control. Positive controls included CD19-TAC (SEQ ID NO: 159) T cells in co-culture with NALM6GUCY2C target cells and HER2-TAC (SEQ ID NO: 157) T cells in co-culture with N87GUCY2C target cells. The majority of GUCY2C-engineered T cell products proliferated at a magnitude that was comparable to or exceeded proliferation of positive control TAC T cells.
Example 5: In Vitro Cytotoxicity of GUCY2C-TAC T Cells in a Repeat Killing Assay
[0162] T cells were engineered with various non-humanized and humanized GUCY2C-TAC receptors as listed in Table 7. GUCY2C-TAC T cells are co-cultured with 5×104 NALM6GUCY2C/eGFP target cells/well at E:T ratio of 3:1. Following a 3-to-4-day co-culture. GUCY2C-TAC T cells were collected from all wells and counted. These isolated T cells were then again co-cultured with fresh NALM6GUCY2C/eGFP target cells. This process was repeated over multiple consecutive rounds using the same TAC T cells to mimic a chronic stimulating environment. The area of GFP-expressing cells was calculated at the beginning and end of each round and was indicative of the number of live tumor cells. A total of 9 rounds were completed. As a positive control, CD19-TAC T cells were used. Negative controls included wells with target cells alone as well as target cells in co-culture with non-transduced T cells (NTD). Overall findings are summarized below.
[0163] Cytotoxicity (FIG. 4A ): All constructs tested were able to induce tumor target cell death over 9 rounds and a total of 32 days.
[0164] Long-term persistence and proliferation (FIG. 4B ): The repeat killing assay shows that the level of proliferation decreased over time while cells remained functional as they continued to effectively kill tumor cells in successive rounds.
[0165] TAC T cell phenotype and cell composition (FIG. 4C ): At the beginning of the experiment and after rounds 1, 5 and 9, GUCY2C-TAC T cells were phenotyped using flow cytometry. The percentages of CD4+ and CD8+ cells were graphed and show that GUCY2C-TAC T cells become enriched in CD8+ T cells in co-culture. The proportion of TCRαβ+ cells expressing the transduction marker, mStrawberry (mStraw), was also examined. This analysis shows that the mStraw+ fraction of T cells engineered with the various humanized GUCY2C-TAC receptors initially increased by round 5, which then decreased by round 9, with mStraw-negative cells being generally more abundant at the end of the assay. GUCY2C-TAC T cells were also stained for the activation/exhaustion marker, CD69. Specifically. CD8+CD69+ proportions of cells increased over time. GUCY2C-TAC T cells were also stained for combination of exhaustion markers by first gating on CD8+ T cells. The CD8+CD39+ T cells were then examined for LAG3 and PD-1 expression. The data show that the combination of LAG3/PD-1/CD39 exhaustion markers did not meaningfully increase in CD8+ T cells.
[0166] Repeat cytotoxicity and associated observations of T cells expressing TAC constructs with humanized nanobodies were equivalent to those obtained with the TAC receptor featuring the parental G22 nanobody.
Example 6: In Vivo Activity of GUCY2C-TAC T Cells Against NALM6 Leukemia Tumor Cells Expressing GUCY2C
[0167] NALM6 leukemia tumor cells constitutively expressing (i) a truncated GUCY2C protein comprising the extracellular and transmembrane domains and (ii) luciferase (eLuc) were injected into NSG mice via the tail vein and allowed to establish for 12 days prior to treatment (FIG. 5A ). Treatment consisted of a sub-therapeutic dose of 1 million TAC+ T cells (both non-humanized and humanized GUCY2C-TAC variants, CD19-TAC, or non-transduced cells matching the total number of T cells equivalent to 1 million TAC+ T cells) given as a single bolus injection. Tumor burden is represented by the strength of the bioluminescent signal obtained by weekly in vivo imaging. The data demonstrate that G22, G22H8, G22H1, and G22H5 GUCY2C-TAC T cell products were able to control the tumor and induce lasting tumor regression.
[0168] Survival curves of mice carrying NALM6eLue/GUCY2C tumors treated with either (1) GUCY2C-TAC T cells (Table 7), (2) CD19-TAC T cells (control), (3) non-transduced T cells (NTD), or (4) left untreated (NT) (negative controls). As shown in FIG. 5B , the results confirm that G22, G22H8, G22H1, and G22H5 GUCY2C-TAC T cell products induced a survival benefit surpassing the efficacy achieved with the CD19-TAC control. G22H8 demonstrates more potent anti-tumor properties, by inducing tumor regression and animal survival, relative to the parental non-humanized G22 TAC variant.
Example 7: In Vivo Activity of GUCY2C-TAC T Cells Against N87 Gastric Cancer Cells Expressing GUCY2C
[0169] N87 gastric tumor cells constitutively expressing GUCY2C were subcutaneously injected into the hind flank of NSG mice to form solid tumor xenografts. Tumors were grown for 9 days prior to treatment. Tumor-bearing mice were treated with either 1 or 6 million TAC+ T cells engineered with either non-humanized or humanized GUCY2C-TAC variants, or non-transduced cells (NTD) matching the total number of T cells equivalent to 6 million TAC+T cells. Controls included a no-treatment group (NT) and 6 million HER2-TAC T positive control. All cells were injected as a single dose into animals via the tail vein. Tumor burden was measured via caliper measurements twice per week. As shown in FIG. 6 , the data demonstrate that all GUCY2C-TAC T products were able to exert some level of tumor control and lasting tumor regression with G22H8 demonstrating more potent tumor regression relative to the parental non-humanized G22 TAC variant.
Example 8: Binding Specificity of the G22H8 Nanobody
[0170] Binding specificity of G22H8 was analyzed using a membrane protein screen. The G22H8 nanobody was expressed as a GFP fusion protein and was purified and tested for its ability to bind to GUCY2C expressed on the human HEK cell line (FIG. 7A ). Fluorescence was measured after incubating target cells, engineered either with the empty vector control or GUCY2C-expressing plasmid, with the fusion protein at various concentrations. Concentration-dependent binding of the recombinant G22H8-GFP protein to the HEK-GUCY2C expressing cell line was observed, confirming the ability of the G22H8 nanobody to bind the GUCY2C antigen. The binding specificity was established using a membrane proteome array technology that consists of over 6,000 human membrane proteins and represents ˜94% of all single-pass, multi-pass, and glycosylphosphatidylinositol (GPI)-anchored human proteins. In this study, G22H8-GFP was found to bind selectively to GUCY2C and no other protein (FIG. 7B ).
Example 9: GUCY2C Expression Levels in Colorectal Cancer Cells
[0171] Expression of GUCY2C was evaluated in cancer cells naturally and ectopically expressing GUCY2C. Expression was evaluated via flow cytometry (FIG. 8 ) and mRNA analysis by ddPCR (FIG. 9 ). Cell lines endogenously expressing GUCY2C included SW1463 (adenocarcinoma; colorectal; Dukes' type C), T84 (carcinoma; colorectal), LS1034 (cecum adenocarcinoma), H508 (cecum adenocarcinoma). Cell lines engineered to overexpress GUCY2C included HCT116 (colorectal carcinoma) and N87 (gastric tubular adenocarcinoma). The data show varying levels of antigen expression with SW1463 and H508 presenting lower GUCY2C levels compared to engineered cell lines and T84 or LS1034. No GUCY2C expression was observed in HCT116 and SW480 cells.
Example 10: In Vitro Early Activation Assay of GUCY2C-TAC T Cells
[0172] A subset of T cells was engineered to express humanized GUCY2C-TAC receptors as listed in Table 7. GUCY2C-TAC T cells were co-cultured with various target cells both endogenous as well as engineered. Following 4 hours of co-culture, cells were stained for the CD69 early activation marker.
[0173] An example flow plot is shown (FIG. 10 ) with the normalized results for various GUCYC-TAC constructs shown as bar graph (FIG. 11 ). The data demonstrate that GUCY2C-TAC T cells become activated when cocultured with antigen positive target cells. No reactivity was observed in co-culture with GUCY2C-negative cells such as HCT116 and N87. The observed activity was generally comparable to HER2-TAC T reference cells for all GUCY2C-TAC candidates tested. T cell activation was similar across a wide range of antigen surface expression levels provided by SW1463 expressing low levels and engineered N87GUCY2C cells expressing high levels. Cancer cells did not lead to activation of non-transduced T cells (NTD) further indicating that the activity observed in TAC T cells was antigen-dependent.
Example 11: In Vitro Cytokine Production Assay of GUCY2C-TAC T Cells
[0174] A subset of T cells was engineered to express humanized GUCY2C-TAC receptors as listed in Table 7. GUCY2C-TAC T cells were co-cultured with various target cells both endogenous as well as engineered. Following 4 hours of co-culture cells were permeabilized and stained for the cytokines.
[0175] An example flow plot is shown (FIG. 12 ) with the normalized results for various GUCY2C-TAC constructs shown as bar graph (FIG. 13 ). The data demonstrate that GUCY2C-TAC T cells produce increased levels of cytokines when cocultured with antigen positive target cells. No reactivity was observed in the absence of the GUCY2C antigen. GUCY2C-TAC T cells were able to engage and be activated by target cells expressing endogenous GUCY2C antigen at various levels. Cytokine production across all GUCY2C-TAC variants was comparable. When comparing activation of GUCY2C-TAC T cells against HER2-TAC in engineered cell lines, GUCY2C-TAC T cells were similar or superior compared to the HER2-TAC reference. Cancer cells did not lead to activation of non-transduced T cells (NTD).
Example 12: In Vitro Cytotoxicity of GUCY2C-TAC T Cells
[0176] A subset of T cells was engineered to express humanized GUCY2C-TAC receptors as listed in Table 7. GUCY2C-TAC T cells were co-cultured with various target cells both endogenous as well as engineered. T cells were co-cultured with various target cells for 5 days. Target cells were engineered with GFP, and loss of GFP was used to assess cytotoxicity.
[0177] Data demonstrate that all GUCY2C-TAC candidates were able to induce cytotoxicity comparable to the HER2-TAC reference (FIG. 14 ). Specifically, GUCY2C-TAC T cells were able to induce cytotoxicity in LS1034 target cells which endogenously express the GUCY2C antigen.
| Sequence Listing | ||
| SEQ | ||
| ID | Nucleotide/ | |
| NO | Amino Acid | Sequence |
| 1 | Nucleotide | ATGGATTTCCAGGTCCAGATTTTCTCCTTCCTGCTGATTTCCGCAAGCGTCATT |
| 2 | Amino Acid | MDFQVQIFSFLLISASVI |
| 3 | Nucleotide | GAACAGAAACTGATTAGCGAAGAAGACCTG |
| 4 | Amino Acid | EQKLISEEDL |
| 5 | Nucleotide | ACTAGTGGCGGAGGAGGATCACTCGAG |
| 6 | Amino Acid | TSGGGGSLE |
| 7 | Nucleotide | AACCCCGGGGGAGGAGGAGGGAGCGGGGGAGGAGGCAGCGGCGGGGGAGGCTCTGGAGGAGGAGGGAGC |
| GGATCC | ||
| 8 | Amino Acid | NPGGGGGSGGGGSGGGGSGGGGSGS |
| 9 | Nucleotide | AGCGGACAGGTGCTGCTGGAATCCAATATCAAAGTCCTGCCCACTTGGTCTACCCCCGTGCAGCCT |
| 10 | Amino Acid | SGQVLLESNIKVLPTWSTPVQP |
| 11 | Nucleotide | GCCGAAGCAGCAGCAAAGGAGGCCGCAGCGAAGGAAGCAGCTGCGAAGGCC |
| 12 | Amino Acid | AEAAAKEAAAKEAAAKA |
| 13 | Nucleotide | GCCGAGGCAGCTGCAAAGGAAGCTGCGGCGAAGGAGGCCGCAGCGAAAGAAGCAGCGGCAAAAGAAGCA |
| GCCGCCAAAGCC | ||
| 14 | Amino Acid | AEAAAKEAAAKEAAAKEAAAKEAAAKA |
| 15 | Nucleotide | ATCGTAGTGTTGGCATTTCAAAAAGCGTCTAGCATCGTCTATAAGAAGGAAGGTGAACAAGTCGAGTTT |
| TCTTTCCCCCTTGCATTTACGGTGGAAAAGCTTACGGGTAGCGGCGAGCTGTGGTGGCAAGCTGAACGG | ||
| GCTTCAAGCTCAAAATCTTGGATTACTTTTGACTTGAAGAACAAAGAGGTGAGTGTCAAAAGAGTTACT | ||
| CAGGACCCAAAGCTTCAAATGGGGAAGAAACTTCCGCTGCACCTGACGTTGCCTCAGGCCCTGCCTCAA | ||
| TATGCCGGCTCAGGCAATCTGACCCTCGCGCTGGAAGCTAAGACCGGAAAATTGCACCAGGAAGTCAAT | ||
| TTGGTTGTGATGCGCGCCACTCAGCTCCAAAAAAATCTCACTTGCGAGGTATGGGGGCCTACGAGCCCA | ||
| AAACTTATGCTGTCTTTGAAGCTTGAAAACAAGGAAGCGAAAGTTTCTAAGCGCGAGAAAGCGGTATGG | ||
| GTTTTGAATCCTGAGGCTGGAATGTGGCAATGCCTCCTGAGCGATAGCGGGCAGGTGCTGTTGGAGAGC | ||
| AACATCAAGGTTTTGCCAGCAGCC | ||
| 16 | Amino Acid | IVVLAFQKASSIVYKKEGEQVEFSFPLAFTVEKLTGSGELWWQAERASSSKSWITFDLKNKEVSVKRVT |
| QDPKLQMGKKLPLHLTLPQALPQYAGSGNLTLALEAKTGKLHQEVNLVVMRATQLQKNLTCEVWGPTSP | ||
| KLMLSLKLENKEAKVSKREKAVWVLNPEAGMWQCLLSDSGQVLLESNIKVLPAA | ||
| 17 | Nucleotide | ATGGAGACCCCCGCCCAGCTGCTGTTCCTGCTGCTGCTGTGGCTGCCCGACACCACCGGC |
| 18 | Amino Acid | METPAQLLFLLLLWLPDTTG |
| 19 | Nucleotide | ATGGCCCTGCCAGTGACCGCCCTGCTGCTGCCACTGGCCCTGCTGCTGCACGCCGCCAGACCC |
| 20 | Amino Acid | MALPVTALLLPLALLLHAARP |
| 21 | Nucleotide | GGATCTACCAGCGGATCCGGCAAGCCTGGCAGCGGAGAGGGATCCACAAAGGGA |
| 22 | Amino Acid | GSTSGSGKPGSGEGSTKG |
| 23 | Nucleotide | ggcggcggcggaagtggaggaggaggctcaggcggaggagggagc |
| 24 | Amino Acid | GGGGSGGGGSGGGGS |
| 25 | Nucleotide | ggaggaggagggagcgggggaggaggcagcggcgggggaggctctggaggaggagggagc |
| 26 | Amino Acid | GGGGSGGGGSGGGGSGGGGS |
| 27 | Nucleotide | GGAGGAGGAGGGAGC |
| 28 | Amino Acid | GGGGS |
| 29 | Nucleotide | ATGGCCCTGCCAGTGACCGCCCTGCTGCTGCCACTGGCCCTGCTGCTGCACGCCGCCCGGCCT |
| 30 | Amino Acid | MALPVTALLLPLALLLHAARP |
| 31 | Nucleotide | ATGGACATCCAGATGACTCAGACCACAAGCTCCCTGTCTGCAAGTCTGGGCGACCGGGTGACAATCTCC |
| TGCAGAGCCTCTCAGGATATTAGGAACTACCTGAATTGGTATCAGCAGAAACCTGATGGCACAGTCAAG | ||
| CTGCTGATCTACTATACCAGCCGGCTGCACTCAGGCGTGCCAAGCAAATTCTCAGGAAGCGGCTCCGGG | ||
| ACTGACTACTCCCTGACCATCTCTAACCTGGAGCAGGAAGATATTGCTACCTATTTCTGCCAGCAGGGC | ||
| AATACACTGCCCTGGACTTTTGCCGGAGGCACCAAACTGGAGATCAAGGGGGGAGGCGGGAGTGGAGGC | ||
| GGGGGATCAGGAGGAGGAGGCAGCGGAGGAGGAGGGTCCGAGGTCCAGCTGCAGCAGAGCGGACCAGAA | ||
| CTGGTGAAGCCCGGAGCAAGTATGAAAATCTCCTGTAAGGCCTCAGGATACAGCTTCACCGGCTATACA | ||
| ATGAACTGGGTGAAACAGTCCCATGGCAAGAACCTGGAATGGATGGGGCTGATTAATCCTTACAAAGGC | ||
| GTCAGCACCTATAATCAGAAGTTTAAAGACAAGGCCACACTGACTGTGGATAAGTCTAGTTCAACCGCT | ||
| TACATGGAGCTGCTGTCCCTGACATCTGAAGACAGTGCCGTGTACTATTGTGCTCGGTCTGGCTACTAT | ||
| GGGGACAGTGATTGGTACTTCGATGTCTGGGGACAGGGCACTACCCTGACCGTGTTTTCT | ||
| 32 | Amino Acid | MDIQMTQTTSSLSASLGDRVTISCRASQDIRNYLNWYQQKPDGTVKLLIYYTSRLHSGVPSKESGSGSG |
| TDYSLTISNLEQEDIATYFCQQGNTLPWTFAGGTKLEIKGGGGSGGGGSGGGGSGGGGSEVQLQQSGPE | ||
| LVKPGASMKISCKASGYSFTGYTMNWVKQSHGKNLEWMGLINPYKGVSTYNQKFKDKATLTVDKSSSTA | ||
| YMELLSLTSEDSAVYYCARSGYYGDSDWYFDVWGQGTTLTVES | ||
| 33 | Nucleotide | ATGGCCGACATCGTGCTGACACAGAGCCCCGCCATCATGTCTGCCAGCCCTGGCGAGAAAGTGACCATG |
| ACCTGTAGCGCCAGCAGCAGCGTGTCCTACATGAACTGGTATCAGCAGAAGTCCGGCACCAGCCCCAAG | ||
| CGGTGGATCTACGACACAAGCAAGCTGGCCTCTGGCGTGCCCGCCCACTTTAGAGGCTCTGGCAGCGGC | ||
| ACAAGCTACAGCCTGACCATCAGCGGCATGGAAGCCGAGGATGCCGCCACCTACTACTGCCAGCAGTGG | ||
| TCCAGCAACCCCTTCACCTTTGGCTCCGGCACAAAGCTGGAAATCAACCGGGCCGACACCGCCCCTACA | ||
| GGCGGCGGAGGATCTGGCGGAGGCGGATCTGGGGGCGGAGGAAGTGGGGGGGGAGGATCTATGGCTCAG | ||
| GTGCAGCTGCAGCAGTCTGGCGCCGAACTGGCTAGACCTGGCGCCTCCGTGAAGATGAGCTGCAAGGCC | ||
| AGCGGCTACACCTTCACCCGGTACACCATGCACTGGGTCAAGCAGAGGCCTGGACAGGGCCTGGAATGG | ||
| ATCGGCTACATCAACCCCAGCCGGGGCTACACCAACTACAACCAGAAGTTCAAGGACAAGGCCACCCTG | ||
| ACCACCGACAAGAGCAGCAGCACCGCCTACATGCAGCTGTCCTCCCTGACCAGCGAGGACAGCGCCGTG | ||
| TACTACTGCGCCCGGTACTACGACGACCACTACTCCCTGGACTACTGGGGCCAGGGCACCACACTGACC | ||
| GTGTCTAGTA | ||
| 34 | Amino Acid | MADIVLTQSPAIMSASPGEKVTMTCSASSSVSYMNWYQQKSGTSPKRWIYDTSKLASGVPAHERGSGSG |
| TSYSLTISGMEAEDAATYYCQQWSSNPFTFGSGTKLEINRADTAPTGGGGSGGGGSGGGGSGGGGSMAQ | ||
| VQLQQSGAELARPGASVKMSCKASGYTFTRYTMHWVKQRPGQGLEWIGYINPSRGYTNYNQKEKDKATL | ||
| TTDKSSSTAYMQLSSLTSEDSAVYYCARYYDDHYSLDYWGQGTTLTVSS | ||
| 35 | Nucleotide | CAGACCGTGGTGACCCAGGAGCCCAGCCTGACCGTGAGCCCCGGCGGCACCGTGACCCTGACCTGCGGC |
| AGCAGCACCGGCGCCGTGACCAGCGGCTACTACCCCAACTGGGTGCAGCAGAAGCCCGGCCAGGCCCCC | ||
| AGGGGCCTGATCGGCGGCACCAAGTTCCTGGCCCCCGGCACCCCCGCCAGGTTCAGCGGCAGCCTGCTG | ||
| GGCGGCAAGGCCGCCCTGACCCTGAGCGGCGTGCAGCCCGAGGACGAGGCCGAGTACTACTGCGCCCTG | ||
| TGGTACAGCAACAGGTGGGTGTTCGGCGGCGGCACCAAGCTGACCGTGCTGGGCGGCGGCGGCAGCGGC | ||
| GGCGGCGGCAGCGGCGGCGGCGGCAGCGAGGTGCAGCTGCTGGAGAGCGGCGGCGGCCTGGTGCAGCCC | ||
| GGCGGCAGCCTGAAGCTGAGCTGCGCCGCCAGCGGCTTCACCTTCAACATCTACGCCATGAACTGGGTG | ||
| AGGCAGGCCCCCGGCAAGGGCCTGGAGTGGGTGGCCAGGATCAGGAGCAAGTACAACAACTACGCCACC | ||
| TACTACGCCGACAGCGTGAAGAGCAGGTTCACCATCAGCAGGGACGACAGCAAGAACACCGCCTACCTG | ||
| CAGATGAACAACCTGAAGACCGAGGACACCGCCGTGTACTACTGCGTGAGGCACGGCAACTTCGGCAAC | ||
| AGCTACGTGAGCTTCTTCGCCTACTGGGGCCAGGGCACCCTGGTGACCGTGAGCAGC | ||
| 36 | Amino Acid | QTVVTQEPSLTVSPGGTVTLTCGSSTGAVTSGYYPNWVQQKPGQAPRGLIGGTKFLAPGTPARFSGSLL |
| GGKAALTLSGVQPEDEAEYYCALWYSNRWVFGGGTKLTVLGGGGSGGGGSGGGGSEVQLLESGGGLVQP | ||
| GGSLKLSCAASGFTFNIYAMNWVRQAPGKGLEWVARIRSKYNNYATYYADSVKSRFTISRDDSKNTAYL | ||
| QMNNLKTEDTAVYYCVRHGNEGNSYVSFFAYWGQGTLVTVSS | ||
| 37 | Nucleotide | GACATCCAGCTGACCCAGAGCCCCGCCATCATGAGCGCCAGCCCCGGCGAGAAGGTGACCATGACCTGC |
| AGGGCCAGCAGCAGCGTGAGCTACATGAACTGGTACCAGCAGAAGAGCGGCACCAGCCCCAAGAGGTGG | ||
| ATCTACGACACCAGCAAGGTGGCCAGCGGCGTGCCCTACAGGTTCAGCGGCAGCGGCAGCGGCACCAGC | ||
| TACAGCCTGACCATCAGCAGCATGGAGGCCGAGGACGCCGCCACCTACTACTGCCAGCAGTGGAGCAGC | ||
| AACCCCCTGACCTTCGGCGCCGGCACCAAGCTGGAGCTGAAGGGCGGCGGCGGCAGCGGCGGCGGCGGC | ||
| AGCGGCGGCGGCGGCAGCGACATCAAGCTGCAGCAGAGCGGCGCCGAGCTGGCCAGGCCCGGCGCCAGC | ||
| GTGAAGATGAGCTGCAAGACCAGCGGCTACACCTTCACCAGGTACACCATGCACTGGGTGAAGCAGAGG | ||
| CCCGGCCAGGGCCTGGAGTGGATCGGCTACATCAACCCCAGCAGGGGCTACACCAACTACAACCAGAAG | ||
| TTCAAGGACAAGGCCACCCTGACCACCGACAAGAGCAGCAGCACCGCCTACATGCAGCTGAGCAGCCTG | ||
| ACCAGCGAGGACAGCGCCGTGTACTACTGCGCCAGGTACTACGACGACCACTACTGCCTGGACTACTGG | ||
| GGCCAGGGCACCACCCTGACCGTGAGCAGC | ||
| 38 | Amino Acid | DIQLTQSPAIMSASPGEKVTMTCRASSSVSYMNWYQQKSGTSPKRWIYDTSKVASGVPYRESGSGSGTS |
| YSLTISSMEAEDAATYYCQQWSSNPLTFGAGTKLELKGGGGSGGGGSGGGGSDIKLQQSGAELARPGAS | ||
| VKMSCKTSGYTFTRYTMHWVKQRPGQGLEWIGYINPSRGYTNYNQKFKDKATLTTDKSSSTAYMQLSSL | ||
| TSEDSAVYYCARYYDDHYCLDYWGQGTTLTVSS | ||
| 39 | Nucleotide | ATGGATATCCAGATGACCCAGTCCCCGAGCTCCCTGTCCGCCTCTGTGGGCGATAGGGTCACCATCACC |
| TGCCGTGCCAGTCAGGACATCCGTAATTATCTGAACTGGTATCAACAGAAACCAGGAAAAGCTCCGAAA | ||
| CTACTGATTTACTATACCTCCCGCCTGGAGTCTGGAGTCCCTTCTCGCTTCTCTGGTTCTGGTTCTGGG | ||
| ACGGATTACACTCTGACCATCAGCAGTCTGCAACCGGAAGACTTCGCAACTTATTACTGTCAGCAAGGT | ||
| AATACTCTGCCGTGGACGTTCGGACAGGGCACCAAGGTGGAGATCAAAGGCGGCGGCGGAAGTGGAGGA | ||
| GGAGGCTCAGGCGGAGGAGGGAGCGAGGTTCAGCTGGTGGAGTCTGGCGGTGGCCTGGTGCAGCCAGGG | ||
| GGCTCACTCCGTTTGTCCTGTGCAGCTTCTGGCTACTCCTTTACCGGCTACACTATGAACTGGGTGCGT | ||
| CAGGCCCCAGGTAAGGGCCTGGAATGGGTTGCACTGATTAATCCTTATAAAGGTGTTAGTACCTACAAC | ||
| CAGAAGTTCAAGGACCGTTTCACTATAAGCGTAGATAAATCCAAAAACACAGCCTACCTGCAAATGAAC | ||
| AGCCTGCGTGCTGAGGACACTGCCGTCTATTATTGTGCTAGAAGCGGATACTACGGCGATAGTGACTGG | ||
| TATTTTGACGTGTGGGGTCAAGGAACCCTGGTCACCGTCTCCTCG | ||
| 40 | Amino Acid | MDIQMTQSPSSLSASVGDRVTITCRASQDIRNYLNWYQQKPGKAPKLLIYYTSRLESGVPSRESGSGSG |
| TDYTLTISSLQPEDFATYYCQQGNTLPWTFGQGTKVEIKGGGGSGGGGSGGGGSEVQLVESGGGLVQPG | ||
| GSLRLSCAASGYSFTGYTMNWVRQAPGKGLEWVALINPYKGVSTYNQKFKDRFTISVDKSKNTAYLQMN | ||
| SLRAEDTAVYYCARSGYYGDSDWYFDVWGQGTLVTVSS | ||
| 41 | Nucleotide | ATGGATATCCAGATGACCCAGTCCCCGAGCTCCCTGTCCGCCTCTGTGGGCGATAGGGTCACCATCACC |
| TGCCGTGCCAGTCAGGACATCCGTAATTATCTGAACTGGTATCAACAGAAACCAGGAAAAGCTCCGAAA | ||
| CTACTGATTTACTATACCTCCCGCCTGGAGTCTGGAGTCCCTTCTCGCTTCTCTGGTTCTGGTTCTGGG | ||
| ACGGATTACACTCTGACCATCAGCAGTCTGCAACCGGAAGACTTCGCAACTTATTACTGTCAGCAAGGT | ||
| AATACTCTGCCGTGGACGTTCGGACAGGGCACCAAGGTGGAGATCAAAGGCGGCGGCGGAAGTGGAGGA | ||
| GGAGGCTCAGGCGGAGGAGGGAGCGAGGTTCAGCTGGTGGAGTCTGGCGGTGGCCTGGTGCAGCCAGGG | ||
| GGCTCACTCCGTTTGTCCTGTGCAGCTTCTGGCTACTCCTTTACCGGCTACACTATGAACTGGGTGCGT | ||
| CAGGCCCCAGGTAAGGGCCTGGAATGGGTTGCACTGATTAATCCTACCAAAGGTGTTAGTACCTACAAC | ||
| CAGAAGTTCAAGGACCGTTTCACTATAAGCGTAGATAAATCCAAAAACACAGCCTACCTGCAAATGAAC | ||
| AGCCTGCGTGCTGAGGACACTGCCGTCTATTATTGTGCTAGAAGCGGATACTACGGCGATAGTGACTGG | ||
| TATTTTGACGTGTGGGGTCAAGGAACCCTGGTCACCGTCTCCTCG | ||
| 42 | Amino Acid | MDIQMTQSPSSLSASVGDRVTITCRASQDIRNYLNWYQQKPGKAPKLLIYYTSRLESGVPSRESGSGSG |
| TDYTLTISSLQPEDFATYYCQQGNTLPWTFGQGTKVEIKGGGGSGGGGSGGGGSEVQLVESGGGLVQPG | ||
| GSLRLSCAASGYSFTGYTMNWVRQAPGKGLEWVALINPTKGVSTYNQKEKDRFTISVDKSKNTAYLQMN | ||
| SLRAEDTAVYYCARSGYYGDSDWYFDVWGQGTLVTVSS | ||
| 43 | Nucleotide | ATGGACATCCAGATGACTCAGACCACAAGCTCCCTGTCTGCAAGTCTGGGCGACCGGGTGACAATCTCC |
| TGCAGAGCCTCTCAGGATATTAGGAACTACCTGAATTGGTATCAGCAGAAACCTGATGGCACAGTCAAG | ||
| CTGCTGATCTACTATACCAGCCGGCTGCACTCAGGCGTGCCAAGCAAATTCTCAGGAAGCGGCTCCGGG | ||
| ACTGACTACTCCCTGACCATCTCTAACCTGGAGCAGGAAGATATTGCTACCTATTTCTGCCAGCAGGGC | ||
| AATACACTGCCCTGGACTTTTGCCGGAGGCACCAAACTGGAGATCAAGGGGGGAGGCGGGAGTGGAGGC | ||
| GGGGGATCAGGAGGAGGAGGCAGCGGAGGAGGAGGGTCCGAGGTCCAGCTGCAGCAGAGCGGACCAGAA | ||
| CTGGTGAAGCCCGGAGCAAGTATGAAAATCTCCTGTAAGGCCTCAGGATACAGCTTCACCGGCTATACA | ||
| ATGAACTGGGTGAAACAGTCCCATGGCAAGAACCTGGAATGGATGGGGCTGATTAATCCTACCAAAGGC | ||
| GTCAGCACCTATAATCAGAAGTTTAAAGACAAGGCCACACTGACTGTGGATAAGTCTAGTTCAACCGCT | ||
| TACATGGAGCTGCTGTCCCTGACATCTGAAGACAGTGCCGTGTACTATTGTGCTCGGTCTGGCTACTAT | ||
| GGGGACAGTGATTGGTACTTCGATGTCTGGGGACAGGGCACTACCCTGACCGTGTTTTCT | ||
| 44 | Amino Acid | MDIQMTQTTSSLSASLGDRVTISCRASQDIRNYLNWYQQKPDGTVKLLIYYTSRLHSGVPSKFSGSGSG |
| TDYSLTISNLEQEDIATYFCQQGNTLPWTFAGGTKLEIKGGGGSGGGGSGGGGSGGGGSEVQLQQSGPE | ||
| LVKPGASMKISCKASGYSFTGYTMNWVKQSHGKNLEWMGLINPTKGVSTYNQKEKDKATLTVDKSSSTA | ||
| YMELLSLTSEDSAVYYCARSGYYGDSDWYFDVWGQGTTLTVES | ||
| 45 | Nucleotide | AGCGGACAGGTGCTGCTGGAATCCAATATCAAAGTCCTGCCCACTTGGTCTACCCCCGTGCAGCCTATG |
| GCTCTGATTGTGCTGGGAGGAGTCGCAGGACTGCTGCTGTTTATCGGGCTGGGAATTTTCTTTTGCGTG | ||
| CGCTGCCGGCACCGGAGAAGGCAGGCCGAGCGCATGAGCCAGATCAAGCGACTGCTGAGCGAGAAGAAA | ||
| ACCTGTCAGTGTCCCCATAGATTCCAGAAGACCTGTTCACCCATT | ||
| 46 | Amino Acid | SGQVLLESNIKVLPTWSTPVQPMALIVLGGVAGLLLFIGLGIFFCVRCRHRRRQAERMSQIKRLLSEKK |
| TCQCPHRFQKTCSPI | ||
| 47 | Nucleotide | CTCGAGCTGAGGCCCGAGGCTTCTAGACCTGCTGCCGGCGGAGCCGTGCACACCAGAGGCCTGGACTTC |
| GCCAGCGACATCTACATCTGGGCCCCTCTGGCCGGCACCTGTGGCGTGCTGCTGCTGAGCCTGGTCATC | ||
| ACCCTGTACTGCAACCACCGGAACCGGCGGAGAGTGTGCAAGTGCCCCAGACCCGTGGTCAAGAGCGGC | ||
| GACAAGCCCAGCCTGAGCGCCAGATACGTG | ||
| 48 | Amino Acid | LELRPEASRPAAGGAVHTRGLDFASDIYIWAPLAGTCGVLLLSLVITLYCNHRNRRRVCKCPRPVVKSG |
| DKPSLSARYV | ||
| 49 | Nucleotide | CTCGAGCTGAGGCCCGAGGCTTCTAGACCTGCTGCCGGCGGAGCCGTGCACACCAGAGGCCTGGACTTC |
| GCCAGCGACATCTACATCTGGGCCCCTCTGGCCGGCACCTGTGGCGTGCTGCTGCTGAGCCTGGTCATC | ||
| ACCCTGTACCTGTGCTGCAGACGGCGGAGAGTGTGCAAGTGCCCCAGACCCGTGGTCAAGAGCGGCGAC | ||
| AAGCCCAGCCTGAGCGCCAGATACGTG | ||
| 50 | Amino Acid | LELRPEASRPAAGGAVHTRGLDFASDIYIWAPLAGTCGVLLLSLVITLYLCCRRRRVCKCPRPVVKSGD |
| KPSLSARYV | ||
| 51 | Nucleotide | CTCGAGAAGAAGTCCACCCTGAAGAAACGGGTGTCCCGGCTGCCCAGACCCGAGACACAGAAGGGCCCC |
| CTGAGCAGCCCTATCACCCTGGGACTGCTGGTGGCCGGCGTGCTGGTGCTGCTGGTGTCTCTGGGAGTG | ||
| GCCATCCACCTGTGCTGCCGGCGGAGAAGGGCCTGCAAGTGCCCCAGACTGCGGTTCATGAAGCAGTTC | ||
| TACAAG | ||
| 52 | Amino Acid | LEKKSTLKKRVSRLPRPETQKGPLSSPITLGLLVAGVLVLLVSLGVAIHLCCRRRRACKCPRLREMKQF |
| YK | ||
| 53 | Amino Acid | QVQLVESGGGLVQPGGSLRLSCAVSRNIASLYRVDWYRQAPGKQRELVAGRTSGGTTTYLDAVEGRFTI |
| SRDNVKDTLYLQMNSLTPEDTAVYYCHAHDHWRDSWGQGTLVTVSS | ||
| 54 | Amino Acid | QVQLVESGGGLVQPGGSLRLSCAVSRNIASLYRVDWYRQAPGKQRELVAGRTSGGTTTYLDAVEGRFTI |
| SRDNVKNTLYLQMNSLTPEDTAVYYCHAHDHWRDSWGQGTLVTVSS | ||
| 55 | Amino Acid | QVQLVESGGGLVQPGGSLRLSCAVSRNIASLYRVDWYRQAPGKQRELVAGRTSGGTTTYLDAVEGRFTI |
| SRDNVKNTLYLQMNSLRAEDTAVYYCHAHDHWRDSWGQGTQVTVSS | ||
| 56 | Amino Acid | QVQLVESGGGLVQPGGSLRLSCAASRNIASLYRVDWVRQAPGKQRELVAGRTSGGTTTYLDAVEGRFTI |
| SRDNVKDTVYLQMNSLRAEDTAVYYCHAHDHWRDSWGQGTLVTVSS | ||
| 57 | Amino Acid | QVQLVESGGGLVQPGGSLRLSCAVSRNIASLYRVDWYRQAPGKGLELVAGRTSGGTTTYLDAVEGRFTI |
| SRDNVKNTVYLQMNSLRAEDTAVYYCHAHDHWRDSWGQGTLVTVSS | ||
| 58 | Amino Acid | QVQLVESGGGLVQPGGSLRLSCAASRNIASLYRVDWYRQAPGKGRELVAGRTSGGTTTYLDAVEGRFTI |
| SRDNVKDTLYLQMNSLRAEDTAVYYCHAHDHWRDSWGQGTLVTVSS | ||
| 59 | Amino Acid | QVQLVESGGGLVQPGGSLRLSCAASRNIASLYRVDWVRQAPGKGLELVAGRTSGGTTTYLDAVEGRFTI |
| SRDNVKNTLYLQMNSLTPEDTAVYYCHAHDHWRDSWGQGTQVTVSS | ||
| 60 | Amino Acid | QVQLVESGGGLVQPGGSLRLSCAASRNIASLYRVDWYRQAPGKGLELVAGRTSGGTTTYLDAVEGRFTI |
| SRDNVKDTLYLQMNSLRAEDTAVYYCHAHDHWRDSWGQGTLVTVSS | ||
| 61 | Amino Acid | QVQLVESGGGLVQPGGSLRLSCAASRNIASLYRVDWYRQAPGKGLELVAGRTSGGTTTYLDAVEGRFTI |
| SRDNVKNTLYLQMNSLRAEDTAVYYCHAHDHWRDSWGQGTLVTVSS | ||
| 62 | Amino Acid | QVQLVESGGGLVQPGGSLRLSCAASRNIASLYRVDWVRQAPGKGLELVAGRTSGGTTTYLDAVEGRFTI |
| SRDNVKNTLYLQMNSLRAEDTAVYYCHAHDHWRDSWGQGTLVTVSS | ||
| 63 | Amino Acid | EVQLVESGGGLVQPGGSLRLSCAASRNIFSLYRVDWYRQAPGKQRELVAGSTSGGTTTYADAVKGRFTI |
| STDNVKDTVYLQMNSLRAEDTAVYYCHAHDHWRDSWGQGTLVTVSS | ||
| 64 | Amino Acid | EVQLVESGGGLVQPGGSLRLSCAASRNIFSLYRVDWVRQAPGKGLELVAGSTSGGTTTYADAVKGRFTI |
| STDNVKDTVYLQMNSLTPEDTAVYYCHAHDHWRDSWGQGTLVTVSS | ||
| 65 | Amino Acid | EVQLVESGGGLVQPGGSLRLSCAASRNIFSLYRVDWYRQAPGKQRELVAGSTSGGTTTYADAVKGRETI |
| SRDNVKNTLYLQMNSLRAEDTAVYYCHAHDHWRDSWGQGTQVTVSS | ||
| 66 | Amino Acid | EVQLVESGGGLVQPGGSLRLSCAASRNIFSLYRVDWYRQAPGKGLELVAGSTSGGTTTYADAVKGRETI |
| STDNVKNTLYLQMNSLTPEDTAVYYCHAHDHWRDSWGQGTLVTVSS | ||
| 67 | Amino Acid | EVQLVESGGGLVQPGGSLRLSCAASRNIFSLYRVDWVRQAPGKGRELVAGSTSGGTTTYADAVKGRETI |
| SRDNVKDTVYLQMNSLRAEDTAVYYCHAHDHWRDSWGQGTLVTVSS | ||
| 68 | Amino Acid | EVQLVESGGGLVQPGGSLRLSCAASRNIFSLYRVDWYRQAPGKGLELVAGSTSGGTTTYADAVKGRFTI |
| STDNVKDTLYLQMNSLRAEDTAVYYCHAHDHWRDSWGQGTLVTVSS | ||
| 69 | Amino Acid | EVQLVESGGGLVQPGGSLRLSCAASRNIFSLYRVDWVRQAPGKQRELVAGSTSGGTTTYADAVKGRETI |
| SRDNVKNTLYLQMNSLRAEDTAVYYCHAHDHWRDSWGQGTLVTVSS | ||
| 70 | Amino Acid | EVQLVESGGGLVQPGGSLRLSCAASRNIFSLYRVDWYRQAPGKGLELVAGSTSGGTTTYADAVKGRFTI |
| SRDNVKNTLYLQMNSLRAEDTAVYYCHAHDHWRDSWGQGTLVTVSS | ||
| 71 | Amino Acid | EVQLVESGGGLVQPGGSLRLSCAASRNIFSLYRVDWVRQAPGKGLELVAGSTSGGTTTYADAVKGRFTI |
| SRDNVKNTLYLQMNSLRAEDTAVYYCHAHDHWRDSWGQGTLVTVSS | ||
| 72 | Amino Acid | RNIASLYRVD |
| 73 | Amino Acid | GRTSGGTTTYLDA |
| 74 | Amino Acid | HAHDHWRDS |
| 75 | Amino Acid | RNIFSLYRVD |
| 76 | Amino Acid | GSTSGGTTTYADA |
| 77 | Amino Acid | HAHDHWRDS |
| 78 | Nucleotide | ATGGCTCTGCCTGTGACAGCTCTGTTGCTGCCTCTGGCTCTGCTGCTGCATGCTGCTAGACCTCAGGTG |
| CAGCTGGTTGAATCTGGCGGAGGATTGGTTCAGCCTGGCGGCTCTCTGAGACTGTCTTGCGCCGTGTCT | ||
| CGGAATATCGCCAGCCTGTACAGAGTGGACTGGTACAGACAGGCCCCTGGCAAGCAGAGAGAGCTGGTC | ||
| GCTGGAAGAACCTCTGGCGGCACCACCACCTATCTGGATGCTGTGGAAGGCCGGTTCACCATCTCTCGG | ||
| GACAACGTGAAGGACACCCTGTACCTGCAGATGAACTCTCTGACCCCTGAGGACACCGCCGTGTACTAC | ||
| TGTCACGCTCACGATCACTGGCGGGACTCTTGGGGACAGGGAACACTGGTCACAGTGTCCTCTGAGCAG | ||
| AAACTGATCAGCGAGGAAGATCTGAATCCTGGCGGCGGTGGAGGCAGCGGAGGTGGCGGGAGTGGCGGA | ||
| GGCGGTTCAGGGGGTGGAGGCTCTGGATCTATGGATATCCAGATGACCCAGTCCCCGAGCTCCCTGTCC | ||
| GCCTCTGTGGGCGATAGGGTCACCATCACCTGCCGTGCCAGTCAGGACATCCGTAATTATCTGAACTGG | ||
| TATCAACAGAAACCAGGAAAAGCTCCGAAACTACTGATTTACTATACCTCCCGCCTGGAGTCTGGAGTC | ||
| CCTTCTCGCTTCTCTGGTTCTGGTTCTGGGACGGATTACACTCTGACCATCAGCAGTCTGCAACCGGAA | ||
| GACTTCGCAACTTATTACTGTCAGCAAGGTAATACTCTGCCGTGGACGTTCGGACAGGGCACCAAGGTG | ||
| GAGATCAAAGGCGGCGGCGGAAGTGGAGGAGGAGGCTCAGGCGGAGGAGGGAGCGAGGTTCAGCTGGTG | ||
| GAGTCTGGCGGTGGCCTGGTGCAGCCAGGGGGCTCACTCCGTTTGTCCTGTGCAGCTTCTGGCTACTCC | ||
| TTTACCGGCTACACTATGAACTGGGTGCGTCAGGCCCCAGGTAAGGGCCTGGAATGGGTTGCACTGATT | ||
| AATCCTTATAAAGGTGTTAGTACCTACAACCAGAAGTTCAAGGACCGTTTCACTATAAGCGTAGATAAA | ||
| TCCAAAAACACAGCCTACCTGCAAATGAACAGCCTGCGTGCTGAGGACACTGCCGTCTATTATTGTGCT | ||
| AGAAGCGGATACTACGGCGATAGTGACTGGTATTTTGACGTGTGGGGTCAAGGAACCCTGGTCACCGTC | ||
| TCCTCGACATCTGGCGGCGGAGGATCTCTGGAATCTGGACAGGTGCTGCTGGAAAGCAACATCAAGGTG | ||
| CTGCCCACCTGGTCTACCCCAGTTCAGCCTATGGCTCTGATTGTGCTTGGCGGAGTTGCCGGCCTGCTG | ||
| CTCTTTATCGGCCTGGGCATCTTCTTTTGCGTGCGGTGCAGACATCGGCGGAGACAGGCTGAGAGAATG | ||
| AGCCAGATCAAGCGGCTGCTGAGCGAGAAGAAAACCTGTCAGTGCCCTCACCGGTTCCAGAAAACATGC | ||
| AGCCCCATC | ||
| 79 | Amino Acid | MALPVTALLLPLALLLHAARPQVQLVESGGGLVQPGGSLRLSCAVSRNIASLYRVDWYRQAPGKQRELV |
| AGRTSGGTTTYLDAVEGRFTISRDNVKDTLYLQMNSLTPEDTAVYYCHAHDHWRDSWGQGTLVTVSSEQ | ||
| KLISEEDLNPGGGGGSGGGGSGGGGSGGGGSGSMDIQMTQSPSSLSASVGDRVTITCRASQDIRNYLNW | ||
| YQQKPGKAPKLLIYYTSRLESGVPSRESGSGSGTDYTLTISSLQPEDFATYYCQQGNTLPWTFGQGTKV | ||
| EIKGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCAASGYSFTGYTMNWVRQAPGKGLEWVALI | ||
| NPYKGVSTYNQKFKDRFTISVDKSKNTAYLQMNSLRAEDTAVYYCARSGYYGDSDWYFDVWGQGTLVTV | ||
| SSTSGGGGSLESGQVLLESNIKVLPTWSTPVQPMALIVLGGVAGLLLFIGLGIFFCVRCRHRRRQAERM | ||
| SQIKRLLSEKKTCQCPHRFQKTCSPI | ||
| 80 | Nucleotide | ATGGCTCTGCCTGTGACAGCTCTGTTGCTGCCTCTGGCTCTGCTGCTGCATGCTGCTAGACCTCAGGTG |
| CAGCTGGTTGAATCTGGCGGAGGATTGGTTCAGCCTGGCGGCTCTCTGAGACTGTCTTGCGCCGTGTCT | ||
| CGGAATATCGCCAGCCTGTACAGAGTGGACTGGTACAGACAGGCCCCTGGCAAGCAGAGAGAGCTGGTC | ||
| GCTGGAAGAACCTCTGGCGGCACCACCACCTATCTGGATGCTGTGGAAGGCCGGTTCACCATCTCTCGG | ||
| GACAACGTGAAGAACACCCTGTACCTGCAGATGAACTCTCTGACCCCTGAGGACACCGCCGTGTACTAC | ||
| TGTCACGCTCACGATCACTGGCGGGACTCTTGGGGACAGGGAACACTGGTCACAGTGTCCTCTGAGCAG | ||
| AAACTGATCAGCGAGGAAGATCTGAATCCTGGCGGCGGTGGAGGCAGCGGAGGTGGCGGGAGTGGCGGA | ||
| GGCGGTTCAGGGGGTGGAGGCTCTGGATCTATGGATATCCAGATGACCCAGTCCCCGAGCTCCCTGTCC | ||
| GCCTCTGTGGGCGATAGGGTCACCATCACCTGCCGTGCCAGTCAGGACATCCGTAATTATCTGAACTGG | ||
| TATCAACAGAAACCAGGAAAAGCTCCGAAACTACTGATTTACTATACCTCCCGCCTGGAGTCTGGAGTC | ||
| CCTTCTCGCTTCTCTGGTTCTGGTTCTGGGACGGATTACACTCTGACCATCAGCAGTCTGCAACCGGAA | ||
| GACTTCGCAACTTATTACTGTCAGCAAGGTAATACTCTGCCGTGGACGTTCGGACAGGGCACCAAGGTG | ||
| GAGATCAAAGGCGGCGGCGGAAGTGGAGGAGGAGGCTCAGGCGGAGGAGGGAGCGAGGTTCAGCTGGTG | ||
| GAGTCTGGCGGTGGCCTGGTGCAGCCAGGGGGCTCACTCCGTTTGTCCTGTGCAGCTTCTGGCTACTCC | ||
| TTTACCGGCTACACTATGAACTGGGTGCGTCAGGCCCCAGGTAAGGGCCTGGAATGGGTTGCACTGATT | ||
| AATCCTTATAAAGGTGTTAGTACCTACAACCAGAAGTTCAAGGACCGTTTCACTATAAGCGTAGATAAA | ||
| TCCAAAAACACAGCCTACCTGCAAATGAACAGCCTGCGTGCTGAGGACACTGCCGTCTATTATTGTGCT | ||
| AGAAGCGGATACTACGGCGATAGTGACTGGTATTTTGACGTGTGGGGTCAAGGAACCCTGGTCACCGTC | ||
| TCCTCGACATCTGGCGGCGGAGGATCTCTGGAATCTGGACAGGTGCTGCTGGAAAGCAACATCAAGGTG | ||
| CTGCCCACCTGGTCTACCCCAGTTCAGCCTATGGCTCTGATTGTGCTTGGCGGAGTTGCCGGCCTGCTG | ||
| CTCTTTATCGGCCTGGGCATCTTCTTTTGCGTGCGGTGCAGACATCGGCGGAGACAGGCTGAGAGAATG | ||
| AGCCAGATCAAGCGGCTGCTGAGCGAGAAGAAAACCTGTCAGTGCCCTCACCGGTTCCAGAAAACATGC | ||
| AGCCCCATC | ||
| 81 | Amino Acid | MALPVTALLLPLALLLHAARPQVQLVESGGGLVQPGGSLRLSCAVSRNIASLYRVDWYRQAPGKQRELV |
| AGRTSGGTTTYLDAVEGRFTISRDNVKNTLYLQMNSLTPEDTAVYYCHAHDHWRDSWGQGTLVTVSSEQ | ||
| KLISEEDLNPGGGGGSGGGGSGGGGSGGGGSGSMDIQMTQSPSSLSASVGDRVTITCRASQDIRNYLNW | ||
| YQQKPGKAPKLLIYYTSRLESGVPSRESGSGSGTDYTLTISSLQPEDFATYYCQQGNTLPWTFGQGTKV | ||
| EIKGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCAASGYSFTGYTMNWVRQAPGKGLEWVALI | ||
| NPYKGVSTYNQKFKDRFTISVDKSKNTAYLQMNSLRAEDTAVYYCARSGYYGDSDWYFDVWGQGTLVTV | ||
| SSTSGGGGSLESGQVLLESNIKVLPTWSTPVQPMALIVLGGVAGLLLFIGLGIFFCVRCRHRRRQAERM | ||
| SQIKRLLSEKKTCQCPHRFQKTCSPI | ||
| 82 | Nucleotide | ATGGCTCTGCCTGTGACAGCTCTGTTGCTGCCTCTGGCTCTGCTGCTGCATGCTGCTAGACCTCAGGTG |
| CAGCTGGTTGAATCTGGCGGAGGATTGGTTCAGCCTGGCGGCTCTCTGAGACTGTCTTGCGCCGTGTCT | ||
| CGGAATATCGCCAGCCTGTACAGAGTGGACTGGTACAGACAGGCCCCTGGCAAGCAGAGAGAGCTGGTC | ||
| GCTGGAAGAACCTCTGGCGGCACCACCACCTATCTGGATGCTGTGGAAGGCCGGTTCACCATCTCTCGG | ||
| GACAACGTGAAGAACACCCTGTACCTGCAGATGAACTCCCTGAGAGCCGAGGACACCGCCGTGTACTAC | ||
| TGTCACGCTCACGATCACTGGCGGGACTCTTGGGGACAGGGCACACAAGTGACAGTGTCCTCTGAGCAG | ||
| AAACTGATCAGCGAGGAAGATCTGAATCCTGGCGGCGGTGGAGGCAGCGGAGGTGGCGGGAGTGGCGGA | ||
| GGCGGTTCAGGGGGTGGAGGCTCTGGATCTATGGATATCCAGATGACCCAGTCCCCGAGCTCCCTGTCC | ||
| GCCTCTGTGGGCGATAGGGTCACCATCACCTGCCGTGCCAGTCAGGACATCCGTAATTATCTGAACTGG | ||
| TATCAACAGAAACCAGGAAAAGCTCCGAAACTACTGATTTACTATACCTCCCGCCTGGAGTCTGGAGTC | ||
| CCTTCTCGCTTCTCTGGTTCTGGTTCTGGGACGGATTACACTCTGACCATCAGCAGTCTGCAACCGGAA | ||
| GACTTCGCAACTTATTACTGTCAGCAAGGTAATACTCTGCCGTGGACGTTCGGACAGGGCACCAAGGTG | ||
| GAGATCAAAGGCGGCGGCGGAAGTGGAGGAGGAGGCTCAGGCGGAGGAGGGAGCGAGGTTCAGCTGGTG | ||
| GAGTCTGGCGGTGGCCTGGTGCAGCCAGGGGGCTCACTCCGTTTGTCCTGTGCAGCTTCTGGCTACTCC | ||
| TTTACCGGCTACACTATGAACTGGGTGCGTCAGGCCCCAGGTAAGGGCCTGGAATGGGTTGCACTGATT | ||
| AATCCTTATAAAGGTGTTAGTACCTACAACCAGAAGTTCAAGGACCGTTTCACTATAAGCGTAGATAAA | ||
| TCCAAAAACACAGCCTACCTGCAAATGAACAGCCTGCGTGCTGAGGACACTGCCGTCTATTATTGTGCT | ||
| AGAAGCGGATACTACGGCGATAGTGACTGGTATTTTGACGTGTGGGGTCAAGGAACCCTGGTCACCGTC | ||
| TCCTCGACATCTGGCGGCGGAGGATCTCTGGAATCTGGACAGGTGCTGCTGGAAAGCAACATCAAGGTG | ||
| CTGCCCACCTGGTCTACCCCAGTTCAGCCTATGGCTCTGATTGTGCTTGGCGGAGTTGCCGGCCTGCTG | ||
| CTCTTTATCGGCCTGGGCATCTTCTTTTGCGTGCGGTGCAGACATCGGCGGAGACAGGCTGAGAGAATG | ||
| AGCCAGATCAAGCGGCTGCTGAGCGAGAAGAAAACCTGTCAGTGCCCTCACCGGTTCCAGAAAACATGC | ||
| AGCCCCATC | ||
| 83 | Amino Acid | MALPVTALLLPLALLLHAARPQVQLVESGGGLVQPGGSLRLSCAVSRNIASLYRVDWYRQAPGKQRELV |
| AGRTSGGTTTYLDAVEGRFTISRDNVKNTLYLQMNSLRAEDTAVYYCHAHDHWRDSWGQGTQVTVSSEQ | ||
| KLISEEDLNPGGGGGSGGGGSGGGGSGGGGSGSMDIQMTQSPSSLSASVGDRVTITCRASQDIRNYLNW | ||
| YQQKPGKAPKLLIYYTSRLESGVPSRFSGSGSGTDYTLTISSLQPEDFATYYCQQGNTLPWTFGQGTKV | ||
| EIKGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCAASGYSFTGYTMNWVRQAPGKGLEWVALI | ||
| NPYKGVSTYNQKFKDRFTISVDKSKNTAYLQMNSLRAEDTAVYYCARSGYYGDSDWYFDVWGQGTLVTV | ||
| SSTSGGGGSLESGQVLLESNIKVLPTWSTPVQPMALIVLGGVAGLLLFIGLGIFFCVRCRHRRRQAERM | ||
| SQIKRLLSEKKTCQCPHRFQKTCSPI | ||
| 84 | Nucleotide | ATGGCTCTGCCTGTGACAGCTCTGTTGCTGCCTCTGGCTCTGCTGCTGCATGCTGCTAGACCTCAGGTG |
| CAGCTGGTTGAATCTGGCGGAGGATTGGTTCAGCCTGGCGGCTCTCTGAGACTGTCTTGTGCCGCCTCT | ||
| CGGAATATCGCCAGCCTGTACAGAGTGGACTGGGTCCGACAGGCTCCTGGCAAACAGAGAGAGCTGGTC | ||
| GCTGGCAGAACCTCTGGCGGCACCACCACATATCTGGATGCCGTGGAAGGCCGGTTCACCATCTCCAGA | ||
| GACAACGTGAAGGACACCGTGTACCTGCAGATGAACTCCCTGAGAGCCGAGGACACCGCCGTGTACTAC | ||
| TGTCACGCTCACGATCACTGGCGGGACTCTTGGGGACAGGGAACACTGGTCACAGTGTCCTCTGAGCAG | ||
| AAACTGATCAGCGAGGAAGATCTGAATCCTGGCGGCGGTGGAGGCAGCGGAGGTGGCGGGAGTGGCGGA | ||
| GGCGGTTCAGGGGGTGGAGGCTCTGGATCTATGGATATCCAGATGACCCAGTCCCCGAGCTCCCTGTCC | ||
| GCCTCTGTGGGCGATAGGGTCACCATCACCTGCCGTGCCAGTCAGGACATCCGTAATTATCTGAACTGG | ||
| TATCAACAGAAACCAGGAAAAGCTCCGAAACTACTGATTTACTATACCTCCCGCCTGGAGTCTGGAGTC | ||
| CCTTCTCGCTTCTCTGGTTCTGGTTCTGGGACGGATTACACTCTGACCATCAGCAGTCTGCAACCGGAA | ||
| GACTTCGCAACTTATTACTGTCAGCAAGGTAATACTCTGCCGTGGACGTTCGGACAGGGCACCAAGGTG | ||
| GAGATCAAAGGCGGCGGCGGAAGTGGAGGAGGAGGCTCAGGCGGAGGAGGGAGCGAGGTTCAGCTGGTG | ||
| GAGTCTGGCGGTGGCCTGGTGCAGCCAGGGGGCTCACTCCGTTTGTCCTGTGCAGCTTCTGGCTACTCC | ||
| TTTACCGGCTACACTATGAACTGGGTGCGTCAGGCCCCAGGTAAGGGCCTGGAATGGGTTGCACTGATT | ||
| AATCCTTATAAAGGTGTTAGTACCTACAACCAGAAGTTCAAGGACCGTTTCACTATAAGCGTAGATAAA | ||
| TCCAAAAACACAGCCTACCTGCAAATGAACAGCCTGCGTGCTGAGGACACTGCCGTCTATTATTGTGCT | ||
| AGAAGCGGATACTACGGCGATAGTGACTGGTATTTTGACGTGTGGGGTCAAGGAACCCTGGTCACCGTC | ||
| TCCTCGACATCTGGCGGCGGAGGATCTCTGGAATCTGGACAGGTGCTGCTGGAAAGCAACATCAAGGTG | ||
| CTGCCCACCTGGTCTACCCCAGTTCAGCCTATGGCTCTGATTGTGCTTGGCGGAGTTGCCGGCCTGCTG | ||
| CTCTTTATCGGCCTGGGCATCTTCTTTTGCGTGCGGTGCAGACATCGGCGGAGACAGGCTGAGAGAATG | ||
| AGCCAGATCAAGCGGCTGCTGAGCGAGAAGAAAACCTGTCAGTGCCCTCACCGGTTCCAGAAAACATGC | ||
| AGCCCCATC | ||
| 85 | Amino Acid | MALPVTALLLPLALLLHAARPQVQLVESGGGLVQPGGSLRLSCAASRNIASLYRVDWVRQAPGKQRELV |
| AGRTSGGTTTYLDAVEGRFTISRDNVKDTVYLQMNSLRAEDTAVYYCHAHDHWRDSWGQGTLVTVSSEQ | ||
| KLISEEDLNPGGGGGSGGGGSGGGGSGGGGSGSMDIQMTQSPSSLSASVGDRVTITCRASQDIRNYLNW | ||
| YQQKPGKAPKLLIYYTSRLESGVPSRESGSGSGTDYTLTISSLQPEDFATYYCQQGNTLPWTFGQGTKV | ||
| EIKGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCAASGYSFTGYTMNWVRQAPGKGLEWVALI | ||
| NPYKGVSTYNQKFKDRFTISVDKSKNTAYLQMNSLRAEDTAVYYCARSGYYGDSDWYFDVWGQGTLVTV | ||
| SSTSGGGGSLESGQVLLESNIKVLPTWSTPVQPMALIVLGGVAGLLLFIGLGIFFCVRCRHRRRQAERM | ||
| SQIKRLLSEKKTCQCPHRFQKTCSPI | ||
| 86 | Nucleotide | ATGGCTCTGCCTGTGACAGCTCTGTTGCTGCCTCTGGCTCTGCTGCTGCATGCTGCTAGACCTCAGGTG |
| CAGCTGGTTGAATCTGGCGGAGGATTGGTTCAGCCTGGCGGCTCTCTGAGACTGTCTTGCGCCGTGTCT | ||
| CGGAATATCGCCAGCCTGTACAGAGTGGACTGGTACAGACAGGCCCCTGGCAAAGGACTGGAACTGGTG | ||
| GCTGGAAGAACCTCTGGCGGCACCACCACCTATCTGGATGCTGTGGAAGGCCGGTTCACCATCTCTCGG | ||
| GACAACGTGAAGAACACCGTGTACCTGCAGATGAACTCCCTGAGAGCCGAGGACACCGCCGTGTACTAC | ||
| TGTCACGCTCACGATCACTGGCGGGACTCTTGGGGACAGGGAACACTGGTCACAGTGTCCTCTGAGCAG | ||
| AAACTGATCAGCGAGGAAGATCTGAATCCTGGCGGCGGTGGAGGCAGCGGAGGTGGCGGGAGTGGCGGA | ||
| GGCGGTTCAGGGGGTGGAGGCTCTGGATCTATGGATATCCAGATGACCCAGTCCCCGAGCTCCCTGTCC | ||
| GCCTCTGTGGGCGATAGGGTCACCATCACCTGCCGTGCCAGTCAGGACATCCGTAATTATCTGAACTGG | ||
| TATCAACAGAAACCAGGAAAAGCTCCGAAACTACTGATTTACTATACCTCCCGCCTGGAGTCTGGAGTC | ||
| CCTTCTCGCTTCTCTGGTTCTGGTTCTGGGACGGATTACACTCTGACCATCAGCAGTCTGCAACCGGAA | ||
| GACTTCGCAACTTATTACTGTCAGCAAGGTAATACTCTGCCGTGGACGTTCGGACAGGGCACCAAGGTG | ||
| GAGATCAAAGGCGGCGGCGGAAGTGGAGGAGGAGGCTCAGGCGGAGGAGGGAGCGAGGTTCAGCTGGTG | ||
| GAGTCTGGCGGTGGCCTGGTGCAGCCAGGGGGCTCACTCCGTTTGTCCTGTGCAGCTTCTGGCTACTCC | ||
| TTTACCGGCTACACTATGAACTGGGTGCGTCAGGCCCCAGGTAAGGGCCTGGAATGGGTTGCACTGATT | ||
| AATCCTTATAAAGGTGTTAGTACCTACAACCAGAAGTTCAAGGACCGTTTCACTATAAGCGTAGATAAA | ||
| TCCAAAAACACAGCCTACCTGCAAATGAACAGCCTGCGTGCTGAGGACACTGCCGTCTATTATTGTGCT | ||
| AGAAGCGGATACTACGGCGATAGTGACTGGTATTTTGACGTGTGGGGTCAAGGAACCCTGGTCACCGTC | ||
| TCCTCGACATCTGGCGGCGGAGGATCTCTGGAATCTGGACAGGTGCTGCTGGAAAGCAACATCAAGGTG | ||
| CTGCCCACCTGGTCTACCCCAGTTCAGCCTATGGCTCTGATTGTGCTTGGCGGAGTTGCCGGCCTGCTG | ||
| CTCTTTATCGGCCTGGGCATCTTCTTTTGCGTGCGGTGCAGACATCGGCGGAGACAGGCTGAGAGAATG | ||
| AGCCAGATCAAGCGGCTGCTGAGCGAGAAGAAAACCTGTCAGTGCCCTCACCGGTTCCAGAAAACATGC | ||
| AGCCCCATC | ||
| 87 | Amino Acid | MALPVTALLLPLALLLHAARPQVQLVESGGGLVQPGGSLRLSCAVSRNIASLYRVDWYRQAPGKGLELV |
| AGRTSGGTTTYLDAVEGRFTISRDNVKNTVYLQMNSLRAEDTAVYYCHAHDHWRDSWGQGTLVTVSSEQ | ||
| KLISEEDLNPGGGGGSGGGGSGGGGSGGGGSGSMDIQMTQSPSSLSASVGDRVTITCRASQDIRNYLNW | ||
| YQQKPGKAPKLLIYYTSRLESGVPSRESGSGSGTDYTLTISSLQPEDFATYYCQQGNTLPWTFGQGTKV | ||
| EIKGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCAASGYSFTGYTMNWVRQAPGKGLEWVALI | ||
| NPYKGVSTYNQKFKDRFTISVDKSKNTAYLQMNSLRAEDTAVYYCARSGYYGDSDWYFDVWGQGTLVTV | ||
| SSTSGGGGSLESGQVLLESNIKVLPTWSTPVQPMALIVLGGVAGLLLFIGLGIFFCVRCRHRRRQAERM | ||
| SQIKRLLSEKKTCQCPHRFQKTCSPI | ||
| 88 | Nucleotide | ATGGCTCTGCCTGTGACAGCTCTGTTGCTGCCTCTGGCTCTGCTGCTGCATGCTGCTAGACCTCAGGTG |
| CAGCTGGTTGAATCTGGCGGAGGATTGGTTCAGCCTGGCGGCTCTCTGAGACTGTCTTGTGCCGCCTCT | ||
| CGGAATATCGCCAGCCTGTACAGAGTGGACTGGTACAGACAGGCCCCTGGCAAGGGAAGAGAACTGGTG | ||
| GCTGGAAGAACCTCTGGCGGCACCACCACCTATCTGGATGCTGTGGAAGGCCGGTTCACCATCTCTCGG | ||
| GACAACGTGAAGGACACCCTGTACCTGCAGATGAACTCCCTGAGAGCCGAGGACACCGCCGTGTACTAC | ||
| TGTCACGCTCACGATCACTGGCGGGACTCTTGGGGACAGGGAACACTGGTCACAGTGTCCTCTGAGCAG | ||
| AAACTGATCAGCGAGGAAGATCTGAATCCTGGCGGCGGTGGAGGCAGCGGAGGTGGCGGGAGTGGCGGA | ||
| GGCGGTTCAGGGGGTGGAGGCTCTGGATCTATGGATATCCAGATGACCCAGTCCCCGAGCTCCCTGTCC | ||
| GCCTCTGTGGGCGATAGGGTCACCATCACCTGCCGTGCCAGTCAGGACATCCGTAATTATCTGAACTGG | ||
| TATCAACAGAAACCAGGAAAAGCTCCGAAACTACTGATTTACTATACCTCCCGCCTGGAGTCTGGAGTC | ||
| CCTTCTCGCTTCTCTGGTTCTGGTTCTGGGACGGATTACACTCTGACCATCAGCAGTCTGCAACCGGAA | ||
| GACTTCGCAACTTATTACTGTCAGCAAGGTAATACTCTGCCGTGGACGTTCGGACAGGGCACCAAGGTG | ||
| GAGATCAAAGGCGGCGGCGGAAGTGGAGGAGGAGGCTCAGGCGGAGGAGGGAGCGAGGTTCAGCTGGTG | ||
| GAGTCTGGCGGTGGCCTGGTGCAGCCAGGGGGCTCACTCCGTTTGTCCTGTGCAGCTTCTGGCTACTCC | ||
| TTTACCGGCTACACTATGAACTGGGTGCGTCAGGCCCCAGGTAAGGGCCTGGAATGGGTTGCACTGATT | ||
| AATCCTTATAAAGGTGTTAGTACCTACAACCAGAAGTTCAAGGACCGTTTCACTATAAGCGTAGATAAA | ||
| TCCAAAAACACAGCCTACCTGCAAATGAACAGCCTGCGTGCTGAGGACACTGCCGTCTATTATTGTGCT | ||
| AGAAGCGGATACTACGGCGATAGTGACTGGTATTTTGACGTGTGGGGTCAAGGAACCCTGGTCACCGTC | ||
| TCCTCGACATCTGGCGGCGGAGGATCTCTGGAATCTGGACAGGTGCTGCTGGAAAGCAACATCAAGGTG | ||
| CTGCCCACCTGGTCTACCCCAGTTCAGCCTATGGCTCTGATTGTGCTTGGCGGAGTTGCCGGCCTGCTG | ||
| CTCTTTATCGGCCTGGGCATCTTCTTTTGCGTGCGGTGCAGACATCGGCGGAGACAGGCTGAGAGAATG | ||
| AGCCAGATCAAGCGGCTGCTGAGCGAGAAGAAAACCTGTCAGTGCCCTCACCGGTTCCAGAAAACATGC | ||
| AGCCCCATC | ||
| 89 | Amino Acid | MALPVTALLLPLALLLHAARPQVQLVESGGGLVQPGGSLRLSCAASRNIASLYRVDWYRQAPGKGRELV |
| AGRTSGGTTTYLDAVEGRFTISRDNVKDTLYLQMNSLRAEDTAVYYCHAHDHWRDSWGQGTLVTVSSEQ | ||
| KLISEEDLNPGGGGGSGGGGSGGGGSGGGGSGSMDIQMTQSPSSLSASVGDRVTITCRASQDIRNYLNW | ||
| YQQKPGKAPKLLIYYTSRLESGVPSRESGSGSGTDYTLTISSLQPEDFATYYCQQGNTLPWTFGQGTKV | ||
| EIKGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCAASGYSFTGYTMNWVRQAPGKGLEWVALI | ||
| NPYKGVSTYNQKFKDRFTISVDKSKNTAYLQMNSLRAEDTAVYYCARSGYYGDSDWYFDVWGQGTLVTV | ||
| SSTSGGGGSLESGQVLLESNIKVLPTWSTPVQPMALIVLGGVAGLLLFIGLGIFFCVRCRHRRRQAERM | ||
| SQIKRLLSEKKTCQCPHRFQKTCSPI | ||
| 90 | Nucleotide | ATGGCTCTGCCTGTGACAGCTCTGTTGCTGCCTCTGGCTCTGCTGCTGCATGCTGCTAGACCTCAGGTG |
| CAGCTGGTTGAATCTGGCGGAGGATTGGTTCAGCCTGGCGGCTCTCTGAGACTGTCTTGTGCCGCCTCT | ||
| CGGAATATCGCCAGCCTGTACAGAGTGGACTGGGTCCGACAGGCTCCTGGCAAAGGACTGGAACTGGTG | ||
| GCTGGCAGAACCTCTGGCGGCACCACCACATATCTGGATGCCGTGGAAGGCCGGTTCACCATCTCCAGA | ||
| GACAACGTGAAGAACACCCTGTACCTGCAGATGAACTCTCTGACCCCTGAGGACACCGCCGTGTACTAC | ||
| TGTCACGCTCACGATCACTGGCGGGACTCTTGGGGACAGGGCACACAAGTGACAGTGTCCTCTGAGCAG | ||
| AAACTGATCAGCGAGGAAGATCTGAATCCTGGCGGCGGTGGAGGCAGCGGAGGTGGCGGGAGTGGCGGA | ||
| GGCGGTTCAGGGGGTGGAGGCTCTGGATCTATGGATATCCAGATGACCCAGTCCCCGAGCTCCCTGTCC | ||
| GCCTCTGTGGGCGATAGGGTCACCATCACCTGCCGTGCCAGTCAGGACATCCGTAATTATCTGAACTGG | ||
| TATCAACAGAAACCAGGAAAAGCTCCGAAACTACTGATTTACTATACCTCCCGCCTGGAGTCTGGAGTC | ||
| CCTTCTCGCTTCTCTGGTTCTGGTTCTGGGACGGATTACACTCTGACCATCAGCAGTCTGCAACCGGAA | ||
| GACTTCGCAACTTATTACTGTCAGCAAGGTAATACTCTGCCGTGGACGTTCGGACAGGGCACCAAGGTG | ||
| GAGATCAAAGGCGGCGGCGGAAGTGGAGGAGGAGGCTCAGGCGGAGGAGGGAGCGAGGTTCAGCTGGTG | ||
| GAGTCTGGCGGTGGCCTGGTGCAGCCAGGGGGCTCACTCCGTTTGTCCTGTGCAGCTTCTGGCTACTCC | ||
| TTTACCGGCTACACTATGAACTGGGTGCGTCAGGCCCCAGGTAAGGGCCTGGAATGGGTTGCACTGATT | ||
| AATCCTTATAAAGGTGTTAGTACCTACAACCAGAAGTTCAAGGACCGTTTCACTATAAGCGTAGATAAA | ||
| TCCAAAAACACAGCCTACCTGCAAATGAACAGCCTGCGTGCTGAGGACACTGCCGTCTATTATTGTGCT | ||
| AGAAGCGGATACTACGGCGATAGTGACTGGTATTTTGACGTGTGGGGTCAAGGAACCCTGGTCACCGTC | ||
| TCCTCGACATCTGGCGGCGGAGGATCTCTGGAATCTGGACAGGTGCTGCTGGAAAGCAACATCAAGGTG | ||
| CTGCCCACCTGGTCTACCCCAGTTCAGCCTATGGCTCTGATTGTGCTTGGCGGAGTTGCCGGCCTGCTG | ||
| CTCTTTATCGGCCTGGGCATCTTCTTTTGCGTGCGGTGCAGACATCGGCGGAGACAGGCTGAGAGAATG | ||
| AGCCAGATCAAGCGGCTGCTGAGCGAGAAGAAAACCTGTCAGTGCCCTCACCGGTTCCAGAAAACATGC | ||
| AGCCCCATC | ||
| 91 | Amino Acid | MALPVTALLLPLALLLHAARPQVQLVESGGGLVQPGGSLRLSCAASRNIASLYRVDWVRQAPGKGLELV |
| AGRTSGGTTTYLDAVEGRFTISRDNVKNTLYLQMNSLTPEDTAVYYCHAHDHWRDSWGQGTQVTVSSEQ | ||
| KLISEEDLNPGGGGGSGGGGSGGGGSGGGGSGSMDIQMTQSPSSLSASVGDRVTITCRASQDIRNYLNW | ||
| YQQKPGKAPKLLIYYTSRLESGVPSRESGSGSGTDYTLTISSLQPEDFATYYCQQGNTLPWTFGQGTKV | ||
| EIKGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCAASGYSFTGYTMNWVRQAPGKGLEWVALI | ||
| NPYKGVSTYNQKFKDRFTISVDKSKNTAYLQMNSLRAEDTAVYYCARSGYYGDSDWYFDVWGQGTLVTV | ||
| SSTSGGGGSLESGQVLLESNIKVLPTWSTPVQPMALIVLGGVAGLLLFIGLGIFFCVRCRHRRRQAERM | ||
| SQIKRLLSEKKTCQCPHRFQKTCSPI | ||
| 92 | Nucleotide | ATGGCTCTGCCTGTGACAGCTCTGTTGCTGCCTCTGGCTCTGCTGCTGCATGCTGCTAGACCTCAGGTG |
| CAGCTGGTTGAATCTGGCGGAGGATTGGTTCAGCCTGGCGGCTCTCTGAGACTGTCTTGTGCCGCCTCT | ||
| CGGAATATCGCCAGCCTGTACAGAGTGGACTGGTACAGACAGGCCCCTGGCAAAGGACTGGAACTGGTG | ||
| GCTGGAAGAACCTCTGGCGGCACCACCACCTATCTGGATGCTGTGGAAGGCCGGTTCACCATCTCTCGG | ||
| GACAACGTGAAGGACACCCTGTACCTGCAGATGAACTCCCTGAGAGCCGAGGACACCGCCGTGTACTAC | ||
| TGTCACGCTCACGATCACTGGCGGGACTCTTGGGGACAGGGAACACTGGTCACAGTGTCCTCTGAGCAG | ||
| AAACTGATCAGCGAGGAAGATCTGAATCCTGGCGGCGGTGGAGGCAGCGGAGGTGGCGGGAGTGGCGGA | ||
| GGCGGTTCAGGGGGTGGAGGCTCTGGATCTATGGATATCCAGATGACCCAGTCCCCGAGCTCCCTGTCC | ||
| GCCTCTGTGGGCGATAGGGTCACCATCACCTGCCGTGCCAGTCAGGACATCCGTAATTATCTGAACTGG | ||
| TATCAACAGAAACCAGGAAAAGCTCCGAAACTACTGATTTACTATACCTCCCGCCTGGAGTCTGGAGTC | ||
| CCTTCTCGCTTCTCTGGTTCTGGTTCTGGGACGGATTACACTCTGACCATCAGCAGTCTGCAACCGGAA | ||
| GACTTCGCAACTTATTACTGTCAGCAAGGTAATACTCTGCCGTGGACGTTCGGACAGGGCACCAAGGTG | ||
| GAGATCAAAGGCGGCGGCGGAAGTGGAGGAGGAGGCTCAGGCGGAGGAGGGAGCGAGGTTCAGCTGGTG | ||
| GAGTCTGGCGGTGGCCTGGTGCAGCCAGGGGGCTCACTCCGTTTGTCCTGTGCAGCTTCTGGCTACTCC | ||
| TTTACCGGCTACACTATGAACTGGGTGCGTCAGGCCCCAGGTAAGGGCCTGGAATGGGTTGCACTGATT | ||
| AATCCTTATAAAGGTGTTAGTACCTACAACCAGAAGTTCAAGGACCGTTTCACTATAAGCGTAGATAAA | ||
| TCCAAAAACACAGCCTACCTGCAAATGAACAGCCTGCGTGCTGAGGACACTGCCGTCTATTATTGTGCT | ||
| AGAAGCGGATACTACGGCGATAGTGACTGGTATTTTGACGTGTGGGGTCAAGGAACCCTGGTCACCGTC | ||
| TCCTCGACATCTGGCGGCGGAGGATCTCTGGAATCTGGACAGGTGCTGCTGGAAAGCAACATCAAGGTG | ||
| CTGCCCACCTGGTCTACCCCAGTTCAGCCTATGGCTCTGATTGTGCTTGGCGGAGTTGCCGGCCTGCTG | ||
| CTCTTTATCGGCCTGGGCATCTTCTTTTGCGTGCGGTGCAGACATCGGCGGAGACAGGCTGAGAGAATG | ||
| AGCCAGATCAAGCGGCTGCTGAGCGAGAAGAAAACCTGTCAGTGCCCTCACCGGTTCCAGAAAACATGC | ||
| AGCCCCATC | ||
| 93 | Amino Acid | MALPVTALLLPLALLLHAARPQVQLVESGGGLVQPGGSLRLSCAASRNIASLYRVDWYRQAPGKGLELV |
| AGRTSGGTTTYLDAVEGRFTISRDNVKDTLYLQMNSLRAEDTAVYYCHAHDHWRDSWGQGTLVTVSSEQ | ||
| KLISEEDLNPGGGGGSGGGGSGGGGSGGGGSGSMDIQMTQSPSSLSASVGDRVTITCRASQDIRNYLNW | ||
| YQQKPGKAPKLLIYYTSRLESGVPSRFSGSGSGTDYTLTISSLQPEDFATYYCQQGNTLPWTFGQGTKV | ||
| EIKGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCAASGYSFTGYTMNWVRQAPGKGLEWVALI | ||
| NPYKGVSTYNQKFKDRFTISVDKSKNTAYLQMNSLRAEDTAVYYCARSGYYGDSDWYFDVWGQGTLVTV | ||
| SSTSGGGGSLESGQVLLESNIKVLPTWSTPVQPMALIVLGGVAGLLLFIGLGIFFCVRCRHRRRQAERM | ||
| SQIKRLLSEKKTCQCPHRFQKTCSPI | ||
| 94 | Nucleotide | ATGGCTCTGCCTGTGACAGCTCTGTTGCTGCCTCTGGCTCTGCTGCTGCATGCTGCTAGACCTCAGGTG |
| CAGCTGGTTGAATCTGGCGGAGGATTGGTTCAGCCTGGCGGCTCTCTGAGACTGTCTTGTGCCGCCTCT | ||
| CGGAATATCGCCAGCCTGTACAGAGTGGACTGGTACAGACAGGCCCCTGGCAAAGGACTGGAACTGGTG | ||
| GCTGGAAGAACCTCTGGCGGCACCACCACCTATCTGGATGCTGTGGAAGGCCGGTTCACCATCTCTCGG | ||
| GACAACGTGAAGAACACCCTGTACCTGCAGATGAACTCCCTGAGAGCCGAGGACACCGCCGTGTACTAC | ||
| TGTCACGCTCACGATCACTGGCGGGACTCTTGGGGACAGGGAACACTGGTCACAGTGTCCTCTGAGCAG | ||
| AAACTGATCAGCGAGGAAGATCTGAATCCTGGCGGCGGTGGAGGCAGCGGAGGTGGCGGGAGTGGCGGA | ||
| GGCGGTTCAGGGGGTGGAGGCTCTGGATCTATGGATATCCAGATGACCCAGTCCCCGAGCTCCCTGTCC | ||
| GCCTCTGTGGGCGATAGGGTCACCATCACCTGCCGTGCCAGTCAGGACATCCGTAATTATCTGAACTGG | ||
| TATCAACAGAAACCAGGAAAAGCTCCGAAACTACTGATTTACTATACCTCCCGCCTGGAGTCTGGAGTC | ||
| CCTTCTCGCTTCTCTGGTTCTGGTTCTGGGACGGATTACACTCTGACCATCAGCAGTCTGCAACCGGAA | ||
| GACTTCGCAACTTATTACTGTCAGCAAGGTAATACTCTGCCGTGGACGTTCGGACAGGGCACCAAGGTG | ||
| GAGATCAAAGGCGGCGGCGGAAGTGGAGGAGGAGGCTCAGGCGGAGGAGGGAGCGAGGTTCAGCTGGTG | ||
| GAGTCTGGCGGTGGCCTGGTGCAGCCAGGGGGCTCACTCCGTTTGTCCTGTGCAGCTTCTGGCTACTCC | ||
| TTTACCGGCTACACTATGAACTGGGTGCGTCAGGCCCCAGGTAAGGGCCTGGAATGGGTTGCACTGATT | ||
| AATCCTTATAAAGGTGTTAGTACCTACAACCAGAAGTTCAAGGACCGTTTCACTATAAGCGTAGATAAA | ||
| TCCAAAAACACAGCCTACCTGCAAATGAACAGCCTGCGTGCTGAGGACACTGCCGTCTATTATTGTGCT | ||
| AGAAGCGGATACTACGGCGATAGTGACTGGTATTTTGACGTGTGGGGTCAAGGAACCCTGGTCACCGTC | ||
| TCCTCGACATCTGGCGGCGGAGGATCTCTGGAATCTGGACAGGTGCTGCTGGAAAGCAACATCAAGGTG | ||
| CTGCCCACCTGGTCTACCCCAGTTCAGCCTATGGCTCTGATTGTGCTTGGCGGAGTTGCCGGCCTGCTG | ||
| CTCTTTATCGGCCTGGGCATCTTCTTTTGCGTGCGGTGCAGACATCGGCGGAGACAGGCTGAGAGAATG | ||
| AGCCAGATCAAGCGGCTGCTGAGCGAGAAGAAAACCTGTCAGTGCCCTCACCGGTTCCAGAAAACATGC | ||
| AGCCCCATC | ||
| 95 | Amino Acid | MALPVTALLLPLALLLHAARPQVQLVESGGGLVQPGGSLRLSCAASRNIASLYRVDWYRQAPGKGLELV |
| AGRTSGGTTTYLDAVEGRFTISRDNVKNTLYLQMNSLRAEDTAVYYCHAHDHWRDSWGQGTLVTVSSEQ | ||
| KLISEEDLNPGGGGGSGGGGSGGGGSGGGGSGSMDIQMTQSPSSLSASVGDRVTITCRASQDIRNYLNW | ||
| YQQKPGKAPKLLIYYTSRLESGVPSRESGSGSGTDYTLTISSLQPEDFATYYCQQGNTLPWTFGQGTKV | ||
| EIKGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCAASGYSFTGYTMNWVRQAPGKGLEWVALI | ||
| NPYKGVSTYNQKFKDRFTISVDKSKNTAYLQMNSLRAEDTAVYYCARSGYYGDSDWYFDVWGQGTLVTV | ||
| SSTSGGGGSLESGQVLLESNIKVLPTWSTPVQPMALIVLGGVAGLLLFIGLGIFFCVRCRHRRRQAERM | ||
| SQIKRLLSEKKTCQCPHRFQKTCSPI | ||
| 96 | Nucleotide | ATGGCTCTGCCTGTGACAGCTCTGTTGCTGCCTCTGGCTCTGCTGCTGCATGCTGCTAGACCTCAGGTG |
| CAGCTGGTTGAATCTGGCGGAGGATTGGTTCAGCCTGGCGGCTCTCTGAGACTGTCTTGTGCCGCCTCT | ||
| CGGAATATCGCCAGCCTGTACAGAGTGGACTGGGTCCGACAGGCTCCTGGCAAAGGACTGGAACTGGTG | ||
| GCTGGCAGAACCTCTGGCGGCACCACCACATATCTGGATGCCGTGGAAGGCCGGTTCACCATCTCCAGA | ||
| GACAACGTGAAGAACACCCTGTACCTGCAGATGAACTCCCTGAGAGCCGAGGACACCGCCGTGTACTAC | ||
| TGTCACGCTCACGATCACTGGCGGGACTCTTGGGGACAGGGAACACTGGTCACAGTGTCCTCTGAGCAG | ||
| AAACTGATCAGCGAGGAAGATCTGAATCCTGGCGGCGGTGGAGGCAGCGGAGGTGGCGGGAGTGGCGGA | ||
| GGCGGTTCAGGGGGTGGAGGCTCTGGATCTATGGATATCCAGATGACCCAGTCCCCGAGCTCCCTGTCC | ||
| GCCTCTGTGGGCGATAGGGTCACCATCACCTGCCGTGCCAGTCAGGACATCCGTAATTATCTGAACTGG | ||
| TATCAACAGAAACCAGGAAAAGCTCCGAAACTACTGATTTACTATACCTCCCGCCTGGAGTCTGGAGTC | ||
| CCTTCTCGCTTCTCTGGTTCTGGTTCTGGGACGGATTACACTCTGACCATCAGCAGTCTGCAACCGGAA | ||
| GACTTCGCAACTTATTACTGTCAGCAAGGTAATACTCTGCCGTGGACGTTCGGACAGGGCACCAAGGTG | ||
| GAGATCAAAGGCGGCGGCGGAAGTGGAGGAGGAGGCTCAGGCGGAGGAGGGAGCGAGGTTCAGCTGGTG | ||
| GAGTCTGGCGGTGGCCTGGTGCAGCCAGGGGGCTCACTCCGTTTGTCCTGTGCAGCTTCTGGCTACTCC | ||
| TTTACCGGCTACACTATGAACTGGGTGCGTCAGGCCCCAGGTAAGGGCCTGGAATGGGTTGCACTGATT | ||
| AATCCTTATAAAGGTGTTAGTACCTACAACCAGAAGTTCAAGGACCGTTTCACTATAAGCGTAGATAAA | ||
| TCCAAAAACACAGCCTACCTGCAAATGAACAGCCTGCGTGCTGAGGACACTGCCGTCTATTATTGTGCT | ||
| AGAAGCGGATACTACGGCGATAGTGACTGGTATTTTGACGTGTGGGGTCAAGGAACCCTGGTCACCGTC | ||
| TCCTCGACATCTGGCGGCGGAGGATCTCTGGAATCTGGACAGGTGCTGCTGGAAAGCAACATCAAGGTG | ||
| CTGCCCACCTGGTCTACCCCAGTTCAGCCTATGGCTCTGATTGTGCTTGGCGGAGTTGCCGGCCTGCTG | ||
| CTCTTTATCGGCCTGGGCATCTTCTTTTGCGTGCGGTGCAGACATCGGCGGAGACAGGCTGAGAGAATG | ||
| AGCCAGATCAAGCGGCTGCTGAGCGAGAAGAAAACCTGTCAGTGCCCTCACCGGTTCCAGAAAACATGC | ||
| AGCCCCATC | ||
| 97 | Amino Acid | MALPVTALLLPLALLLHAARPQVQLVESGGGLVQPGGSLRLSCAASRNIASLYRVDWVRQAPGKGLELV |
| AGRTSGGTTTYLDAVEGRFTISRDNVKNTLYLQMNSLRAEDTAVYYCHAHDHWRDSWGQGTLVTVSSEQ | ||
| KLISEEDLNPGGGGGSGGGGSGGGGSGGGGSGSMDIQMTQSPSSLSASVGDRVTITCRASQDIRNYLNW | ||
| YQQKPGKAPKLLIYYTSRLESGVPSRESGSGSGTDYTLTISSLQPEDFATYYCQQGNTLPWTFGQGTKV | ||
| EIKGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCAASGYSFTGYTMNWVRQAPGKGLEWVALI | ||
| NPYKGVSTYNQKFKDRETISVDKSKNTAYLQMNSLRAEDTAVYYCARSGYYGDSDWYFDVWGQGTLVTV | ||
| SSTSGGGGSLESGQVLLESNIKVLPTWSTPVQPMALIVLGGVAGLLLFIGLGIFFCVRCRHRRRQAERM | ||
| SQIKRLLSEKKTCQCPHRFQKTCSPI | ||
| 98 | Nucleotide | ATGGCTCTGCCTGTGACAGCTCTGTTGCTGCCTCTGGCTCTGCTGCTGCATGCTGCTAGACCTGAGGTG |
| CAGCTGGTTGAATCTGGCGGAGGATTGGTTCAGCCTGGCGGCTCTCTGAGACTGTCTTGTGCCGCCTCT | ||
| CGGAACATCTTCAGCCTGTACAGAGTGGACTGGTACAGACAGGCCCCTGGCAAGCAGAGAGAACTGGTC | ||
| GCTGGATCTACCTCTGGCGGCACCACCACCTATGCCGATGCTGTGAAGGGCAGATTCACCATCTCCACC | ||
| GACAACGTGAAGGACACCGTGTACCTGCAGATGAACTCCCTGAGAGCCGAGGACACCGCCGTGTACTAC | ||
| TGTCACGCTCACGATCACTGGCGGGACTCTTGGGGACAGGGAACACTGGTCACAGTGTCCTCTGAGCAG | ||
| AAACTGATCAGCGAGGAAGATCTGAATCCTGGCGGCGGTGGAGGCAGCGGAGGTGGCGGGAGTGGCGGA | ||
| GGCGGTTCAGGGGGTGGAGGCTCTGGATCTATGGATATCCAGATGACCCAGTCCCCGAGCTCCCTGTCC | ||
| GCCTCTGTGGGCGATAGGGTCACCATCACCTGCCGTGCCAGTCAGGACATCCGTAATTATCTGAACTGG | ||
| TATCAACAGAAACCAGGAAAAGCTCCGAAACTACTGATTTACTATACCTCCCGCCTGGAGTCTGGAGTC | ||
| CCTTCTCGCTTCTCTGGTTCTGGTTCTGGGACGGATTACACTCTGACCATCAGCAGTCTGCAACCGGAA | ||
| GACTTCGCAACTTATTACTGTCAGCAAGGTAATACTCTGCCGTGGACGTTCGGACAGGGCACCAAGGTG | ||
| GAGATCAAAGGCGGCGGCGGAAGTGGAGGAGGAGGCTCAGGCGGAGGAGGGAGCGAGGTTCAGCTGGTG | ||
| GAGTCTGGCGGTGGCCTGGTGCAGCCAGGGGGCTCACTCCGTTTGTCCTGTGCAGCTTCTGGCTACTCC | ||
| TTTACCGGCTACACTATGAACTGGGTGCGTCAGGCCCCAGGTAAGGGCCTGGAATGGGTTGCACTGATT | ||
| AATCCTTATAAAGGTGTTAGTACCTACAACCAGAAGTTCAAGGACCGTTTCACTATAAGCGTAGATAAA | ||
| TCCAAAAACACAGCCTACCTGCAAATGAACAGCCTGCGTGCTGAGGACACTGCCGTCTATTATTGTGCT | ||
| AGAAGCGGATACTACGGCGATAGTGACTGGTATTTTGACGTGTGGGGTCAAGGAACCCTGGTCACCGTC | ||
| TCCTCGACATCTGGCGGCGGAGGATCTCTGGAATCTGGACAGGTGCTGCTGGAAAGCAACATCAAGGTG | ||
| CTGCCCACCTGGTCTACCCCAGTTCAGCCTATGGCTCTGATTGTGCTTGGCGGAGTTGCCGGCCTGCTG | ||
| CTCTTTATCGGCCTGGGCATCTTCTTTTGCGTGCGGTGCAGACATCGGCGGAGACAGGCTGAGAGAATG | ||
| AGCCAGATCAAGCGGCTGCTGAGCGAGAAGAAAACCTGTCAGTGCCCTCACCGGTTCCAGAAAACATGC | ||
| AGCCCCATC | ||
| 99 | Amino Acid | MALPVTALLLPLALLLHAARPEVQLVESGGGLVQPGGSLRLSCAASRNIFSLYRVDWYRQAPGKQRELV |
| AGSTSGGTTTYADAVKGRFTISTDNVKDTVYLQMNSLRAEDTAVYYCHAHDHWRDSWGQGTLVTVSSEQ | ||
| KLISEEDLNPGGGGGSGGGGSGGGGSGGGGSGSMDIQMTQSPSSLSASVGDRVTITCRASQDIRNYLNW | ||
| YQQKPGKAPKLLIYYTSRLESGVPSRESGSGSGTDYTLTISSLQPEDFATYYCQQGNTLPWTFGQGTKV | ||
| EIKGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCAASGYSFTGYTMNWVRQAPGKGLEWVALI | ||
| NPYKGVSTYNQKFKDRFTISVDKSKNTAYLQMNSLRAEDTAVYYCARSGYYGDSDWYFDVWGQGTLVTV | ||
| SSTSGGGGSLESGQVLLESNIKVLPTWSTPVQPMALIVLGGVAGLLLFIGLGIFFCVRCRHRRRQAERM | ||
| SQIKRLLSEKKTCQCPHRFQKTCSPI | ||
| 100 | Nucleotide | ATGGCTCTGCCTGTGACAGCTCTGTTGCTGCCTCTGGCTCTGCTGCTGCATGCTGCTAGACCTGAGGTG |
| CAGCTGGTTGAATCTGGCGGAGGATTGGTTCAGCCTGGCGGCTCTCTGAGACTGTCTTGTGCCGCCTCT | ||
| CGGAACATCTTCAGCCTGTACAGAGTGGACTGGGTCCGACAGGCTCCTGGCAAAGGACTGGAACTGGTG | ||
| GCTGGCTCTACCTCTGGCGGCACCACAACCTATGCCGATGCTGTGAAGGGCAGATTCACCATCTCCACC | ||
| GACAACGTGAAGGACACCGTGTACCTGCAGATGAACTCTCTGACCCCTGAGGACACCGCCGTGTACTAC | ||
| TGTCACGCTCACGATCACTGGCGGGACTCTTGGGGACAGGGAACACTGGTCACAGTGTCCTCTGAGCAG | ||
| AAACTGATCAGCGAGGAAGATCTGAATCCTGGCGGCGGTGGAGGCAGCGGAGGTGGCGGGAGTGGCGGA | ||
| GGCGGTTCAGGGGGTGGAGGCTCTGGATCTATGGATATCCAGATGACCCAGTCCCCGAGCTCCCTGTCC | ||
| GCCTCTGTGGGCGATAGGGTCACCATCACCTGCCGTGCCAGTCAGGACATCCGTAATTATCTGAACTGG | ||
| TATCAACAGAAACCAGGAAAAGCTCCGAAACTACTGATTTACTATACCTCCCGCCTGGAGTCTGGAGTC | ||
| CCTTCTCGCTTCTCTGGTTCTGGTTCTGGGACGGATTACACTCTGACCATCAGCAGTCTGCAACCGGAA | ||
| GACTTCGCAACTTATTACTGTCAGCAAGGTAATACTCTGCCGTGGACGTTCGGACAGGGCACCAAGGTG | ||
| GAGATCAAAGGCGGCGGCGGAAGTGGAGGAGGAGGCTCAGGCGGAGGAGGGAGCGAGGTTCAGCTGGTG | ||
| GAGTCTGGCGGTGGCCTGGTGCAGCCAGGGGGCTCACTCCGTTTGTCCTGTGCAGCTTCTGGCTACTCC | ||
| TTTACCGGCTACACTATGAACTGGGTGCGTCAGGCCCCAGGTAAGGGCCTGGAATGGGTTGCACTGATT | ||
| AATCCTTATAAAGGTGTTAGTACCTACAACCAGAAGTTCAAGGACCGTTTCACTATAAGCGTAGATAAA | ||
| TCCAAAAACACAGCCTACCTGCAAATGAACAGCCTGCGTGCTGAGGACACTGCCGTCTATTATTGTGCT | ||
| AGAAGCGGATACTACGGCGATAGTGACTGGTATTTTGACGTGTGGGGTCAAGGAACCCTGGTCACCGTC | ||
| TCCTCGACATCTGGCGGCGGAGGATCTCTGGAATCTGGACAGGTGCTGCTGGAAAGCAACATCAAGGTG | ||
| CTGCCCACCTGGTCTACCCCAGTTCAGCCTATGGCTCTGATTGTGCTTGGCGGAGTTGCCGGCCTGCTG | ||
| CTCTTTATCGGCCTGGGCATCTTCTTTTGCGTGCGGTGCAGACATCGGCGGAGACAGGCTGAGAGAATG | ||
| AGCCAGATCAAGCGGCTGCTGAGCGAGAAGAAAACCTGTCAGTGCCCTCACCGGTTCCAGAAAACATGC | ||
| AGCCCCATC | ||
| 101 | Amino Acid | MALPVTALLLPLALLLHAARPEVQLVESGGGLVQPGGSLRLSCAASRNIFSLYRVDWVRQAPGKGLELV |
| AGSTSGGTTTYADAVKGRFTISTDNVKDTVYLQMNSLTPEDTAVYYCHAHDHWRDSWGQGTLVTVSSEQ | ||
| KLISEEDLNPGGGGGSGGGGSGGGGSGGGGSGSMDIQMTQSPSSLSASVGDRVTITCRASQDIRNYLNW | ||
| YQQKPGKAPKLLIYYTSRLESGVPSRESGSGSGTDYTLTISSLQPEDFATYYCQQGNTLPWTFGQGTKV | ||
| EIKGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCAASGYSFTGYTMNWVRQAPGKGLEWVALI | ||
| NPYKGVSTYNQKFKDRFTISVDKSKNTAYLQMNSLRAEDTAVYYCARSGYYGDSDWYFDVWGQGTLVTV | ||
| SSTSGGGGSLESGQVLLESNIKVLPTWSTPVQPMALIVLGGVAGLLLFIGLGIFFCVRCRHRRRQAERM | ||
| SQIKRLLSEKKTCQCPHRFQKTCSPI | ||
| 102 | Nucleotide | ATGGCTCTGCCTGTGACAGCTCTGTTGCTGCCTCTGGCTCTGCTGCTGCATGCTGCTAGACCTGAGGTG |
| CAGCTGGTTGAATCTGGCGGAGGATTGGTTCAGCCTGGCGGCTCTCTGAGACTGTCTTGTGCCGCCTCT | ||
| CGGAACATCTTCAGCCTGTACAGAGTGGACTGGTACAGACAGGCCCCTGGCAAGCAGAGAGAACTGGTC | ||
| GCTGGATCTACCTCTGGCGGCACCACCACCTATGCCGATGCTGTGAAGGGCAGATTCACCATCAGCCGG | ||
| GACAACGTGAAGAACACCCTGTACCTGCAGATGAACTCCCTGAGAGCCGAGGACACCGCCGTGTACTAC | ||
| TGTCACGCTCACGATCACTGGCGGGACTCTTGGGGACAGGGCACACAAGTGACAGTGTCCTCTGAGCAG | ||
| AAACTGATCAGCGAGGAAGATCTGAATCCTGGCGGCGGTGGAGGCAGCGGAGGTGGCGGGAGTGGCGGA | ||
| GGCGGTTCAGGGGGTGGAGGCTCTGGATCTATGGATATCCAGATGACCCAGTCCCCGAGCTCCCTGTCC | ||
| GCCTCTGTGGGCGATAGGGTCACCATCACCTGCCGTGCCAGTCAGGACATCCGTAATTATCTGAACTGG | ||
| TATCAACAGAAACCAGGAAAAGCTCCGAAACTACTGATTTACTATACCTCCCGCCTGGAGTCTGGAGTC | ||
| CCTTCTCGCTTCTCTGGTTCTGGTTCTGGGACGGATTACACTCTGACCATCAGCAGTCTGCAACCGGAA | ||
| GACTTCGCAACTTATTACTGTCAGCAAGGTAATACTCTGCCGTGGACGTTCGGACAGGGCACCAAGGTG | ||
| GAGATCAAAGGCGGCGGCGGAAGTGGAGGAGGAGGCTCAGGCGGAGGAGGGAGCGAGGTTCAGCTGGTG | ||
| GAGTCTGGCGGTGGCCTGGTGCAGCCAGGGGGCTCACTCCGTTTGTCCTGTGCAGCTTCTGGCTACTCC | ||
| TTTACCGGCTACACTATGAACTGGGTGCGTCAGGCCCCAGGTAAGGGCCTGGAATGGGTTGCACTGATT | ||
| AATCCTTATAAAGGTGTTAGTACCTACAACCAGAAGTTCAAGGACCGTTTCACTATAAGCGTAGATAAA | ||
| TCCAAAAACACAGCCTACCTGCAAATGAACAGCCTGCGTGCTGAGGACACTGCCGTCTATTATTGTGCT | ||
| AGAAGCGGATACTACGGCGATAGTGACTGGTATTTTGACGTGTGGGGTCAAGGAACCCTGGTCACCGTC | ||
| TCCTCGACATCTGGCGGCGGAGGATCTCTGGAATCTGGACAGGTGCTGCTGGAAAGCAACATCAAGGTG | ||
| CTGCCCACCTGGTCTACCCCAGTTCAGCCTATGGCTCTGATTGTGCTTGGCGGAGTTGCCGGCCTGCTG | ||
| CTCTTTATCGGCCTGGGCATCTTCTTTTGCGTGCGGTGCAGACATCGGCGGAGACAGGCTGAGAGAATG | ||
| AGCCAGATCAAGCGGCTGCTGAGCGAGAAGAAAACCTGTCAGTGCCCTCACCGGTTCCAGAAAACATGC | ||
| AGCCCCATC | ||
| 103 | Amino Acid | MALPVTALLLPLALLLHAARPEVQLVESGGGLVQPGGSLRLSCAASRNIFSLYRVDWYRQAPGKQRELV |
| AGSTSGGTTTYADAVKGRFTISRDNVKNTLYLQMNSLRAEDTAVYYCHAHDHWRDSWGQGTQVTVSSEQ | ||
| KLISEEDLNPGGGGGSGGGGSGGGGSGGGGSGSMDIQMTQSPSSLSASVGDRVTITCRASQDIRNYLNW | ||
| YQQKPGKAPKLLIYYTSRLESGVPSRESGSGSGTDYTLTISSLQPEDFATYYCQQGNTLPWTFGQGTKV | ||
| EIKGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCAASGYSFTGYTMNWVRQAPGKGLEWVALI | ||
| NPYKGVSTYNQKFKDRETISVDKSKNTAYLQMNSLRAEDTAVYYCARSGYYGDSDWYFDVWGQGTLVTV | ||
| SSTSGGGGSLESGQVLLESNIKVLPTWSTPVQPMALIVLGGVAGLLLFIGLGIFFCVRCRHRRRQAERM | ||
| SQIKRLLSEKKTCQCPHRFQKTCSPI | ||
| 104 | Nucleotide | ATGGCTCTGCCTGTGACAGCTCTGTTGCTGCCTCTGGCTCTGCTGCTGCATGCTGCTAGACCTGAGGTG |
| CAGCTGGTTGAATCTGGCGGAGGATTGGTTCAGCCTGGCGGCTCTCTGAGACTGTCTTGTGCCGCCTCT | ||
| CGGAACATCTTCAGCCTGTACAGAGTGGACTGGTACAGACAGGCCCCTGGCAAAGGACTGGAACTGGTG | ||
| GCTGGATCTACCTCTGGCGGCACCACCACCTATGCCGATGCTGTGAAGGGCAGATTCACCATCTCCACC | ||
| GACAACGTGAAGAACACCCTGTACCTGCAGATGAACTCTCTGACCCCTGAGGACACCGCCGTGTACTAC | ||
| TGTCACGCTCACGATCACTGGCGGGACTCTTGGGGACAGGGAACACTGGTCACAGTGTCCTCTGAGCAG | ||
| AAACTGATCAGCGAGGAAGATCTGAATCCTGGCGGCGGTGGAGGCAGCGGAGGTGGCGGGAGTGGCGGA | ||
| GGCGGTTCAGGGGGTGGAGGCTCTGGATCTATGGATATCCAGATGACCCAGTCCCCGAGCTCCCTGTCC | ||
| GCCTCTGTGGGCGATAGGGTCACCATCACCTGCCGTGCCAGTCAGGACATCCGTAATTATCTGAACTGG | ||
| TATCAACAGAAACCAGGAAAAGCTCCGAAACTACTGATTTACTATACCTCCCGCCTGGAGTCTGGAGTC | ||
| CCTTCTCGCTTCTCTGGTTCTGGTTCTGGGACGGATTACACTCTGACCATCAGCAGTCTGCAACCGGAA | ||
| GACTTCGCAACTTATTACTGTCAGCAAGGTAATACTCTGCCGTGGACGTTCGGACAGGGCACCAAGGTG | ||
| GAGATCAAAGGCGGCGGCGGAAGTGGAGGAGGAGGCTCAGGCGGAGGAGGGAGCGAGGTTCAGCTGGTG | ||
| GAGTCTGGCGGTGGCCTGGTGCAGCCAGGGGGCTCACTCCGTTTGTCCTGTGCAGCTTCTGGCTACTCC | ||
| TTTACCGGCTACACTATGAACTGGGTGCGTCAGGCCCCAGGTAAGGGCCTGGAATGGGTTGCACTGATT | ||
| AATCCTTATAAAGGTGTTAGTACCTACAACCAGAAGTTCAAGGACCGTTTCACTATAAGCGTAGATAAA | ||
| TCCAAAAACACAGCCTACCTGCAAATGAACAGCCTGCGTGCTGAGGACACTGCCGTCTATTATTGTGCT | ||
| AGAAGCGGATACTACGGCGATAGTGACTGGTATTTTGACGTGTGGGGTCAAGGAACCCTGGTCACCGTC | ||
| TCCTCGACATCTGGCGGCGGAGGATCTCTGGAATCTGGACAGGTGCTGCTGGAAAGCAACATCAAGGTG | ||
| CTGCCCACCTGGTCTACCCCAGTTCAGCCTATGGCTCTGATTGTGCTTGGCGGAGTTGCCGGCCTGCTG | ||
| CTCTTTATCGGCCTGGGCATCTTCTTTTGCGTGCGGTGCAGACATCGGCGGAGACAGGCTGAGAGAATG | ||
| AGCCAGATCAAGCGGCTGCTGAGCGAGAAGAAAACCTGTCAGTGCCCTCACCGGTTCCAGAAAACATGC | ||
| AGCCCCATC | ||
| 105 | Amino Acid | MALPVTALLLPLALLLHAARPEVQLVESGGGLVQPGGSLRLSCAASRNIFSLYRVDWYRQAPGKGLELV |
| AGSTSGGTTTYADAVKGRFTISTDNVKNTLYLQMNSLTPEDTAVYYCHAHDHWRDSWGQGTLVTVSSEQ | ||
| KLISEEDLNPGGGGGSGGGGSGGGGSGGGGSGSMDIQMTQSPSSLSASVGDRVTITCRASQDIRNYLNW | ||
| YQQKPGKAPKLLIYYTSRLESGVPSRESGSGSGTDYTLTISSLQPEDFATYYCQQGNTLPWTFGQGTKV | ||
| EIKGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCAASGYSFTGYTMNWVRQAPGKGLEWVALI | ||
| NPYKGVSTYNQKFKDRFTISVDKSKNTAYLQMNSLRAEDTAVYYCARSGYYGDSDWYFDVWGQGTLVTV | ||
| SSTSGGGGSLESGQVLLESNIKVLPTWSTPVQPMALIVLGGVAGLLLFIGLGIFFCVRCRHRRRQAERM | ||
| SQIKRLLSEKKTCQCPHRFQKTCSPI | ||
| 106 | Nucleotide | ATGGCTCTGCCTGTGACAGCTCTGTTGCTGCCTCTGGCTCTGCTGCTGCATGCTGCTAGACCTGAGGTG |
| CAGCTGGTTGAATCTGGCGGAGGATTGGTTCAGCCTGGCGGCTCTCTGAGACTGTCTTGTGCCGCCTCT | ||
| CGGAACATCTTCAGCCTGTACAGAGTGGACTGGGTCCGACAGGCTCCTGGCAAGGGAAGAGAACTGGTG | ||
| GCTGGCTCTACCTCTGGCGGCACCACAACCTATGCCGATGCTGTGAAGGGCAGATTCACCATCAGCCGG | ||
| GACAACGTGAAGGACACCGTGTACCTGCAGATGAACTCCCTGAGAGCCGAGGACACCGCCGTGTACTAC | ||
| TGTCACGCTCACGATCACTGGCGGGACTCTTGGGGACAGGGAACACTGGTCACAGTGTCCTCTGAGCAG | ||
| AAACTGATCAGCGAGGAAGATCTGAATCCTGGCGGCGGTGGAGGCAGCGGAGGTGGCGGGAGTGGCGGA | ||
| GGCGGTTCAGGGGGTGGAGGCTCTGGATCTATGGATATCCAGATGACCCAGTCCCCGAGCTCCCTGTCC | ||
| GCCTCTGTGGGCGATAGGGTCACCATCACCTGCCGTGCCAGTCAGGACATCCGTAATTATCTGAACTGG | ||
| TATCAACAGAAACCAGGAAAAGCTCCGAAACTACTGATTTACTATACCTCCCGCCTGGAGTCTGGAGTC | ||
| CCTTCTCGCTTCTCTGGTTCTGGTTCTGGGACGGATTACACTCTGACCATCAGCAGTCTGCAACCGGAA | ||
| GACTTCGCAACTTATTACTGTCAGCAAGGTAATACTCTGCCGTGGACGTTCGGACAGGGCACCAAGGTG | ||
| GAGATCAAAGGCGGCGGCGGAAGTGGAGGAGGAGGCTCAGGCGGAGGAGGGAGCGAGGTTCAGCTGGTG | ||
| GAGTCTGGCGGTGGCCTGGTGCAGCCAGGGGGCTCACTCCGTTTGTCCTGTGCAGCTTCTGGCTACTCC | ||
| TTTACCGGCTACACTATGAACTGGGTGCGTCAGGCCCCAGGTAAGGGCCTGGAATGGGTTGCACTGATT | ||
| AATCCTTATAAAGGTGTTAGTACCTACAACCAGAAGTTCAAGGACCGTTTCACTATAAGCGTAGATAAA | ||
| TCCAAAAACACAGCCTACCTGCAAATGAACAGCCTGCGTGCTGAGGACACTGCCGTCTATTATTGTGCT | ||
| AGAAGCGGATACTACGGCGATAGTGACTGGTATTTTGACGTGTGGGGTCAAGGAACCCTGGTCACCGTC | ||
| TCCTCGACATCTGGCGGCGGAGGATCTCTGGAATCTGGACAGGTGCTGCTGGAAAGCAACATCAAGGTG | ||
| CTGCCCACCTGGTCTACCCCAGTTCAGCCTATGGCTCTGATTGTGCTTGGCGGAGTTGCCGGCCTGCTG | ||
| CTCTTTATCGGCCTGGGCATCTTCTTTTGCGTGCGGTGCAGACATCGGCGGAGACAGGCTGAGAGAATG | ||
| AGCCAGATCAAGCGGCTGCTGAGCGAGAAGAAAACCTGTCAGTGCCCTCACCGGTTCCAGAAAACATGC | ||
| AGCCCCATC | ||
| 107 | Amino Acid | MALPVTALLLPLALLLHAARPEVQLVESGGGLVQPGGSLRLSCAASRNIFSLYRVDWVRQAPGKGRELV |
| AGSTSGGTTTYADAVKGRFTISRDNVKDTVYLQMNSLRAEDTAVYYCHAHDHWRDSWGQGTLVTVSSEQ | ||
| KLISEEDLNPGGGGGSGGGGSGGGGSGGGGSGSMDIQMTQSPSSLSASVGDRVTITCRASQDIRNYLNW | ||
| YQQKPGKAPKLLIYYTSRLESGVPSRFSGSGSGTDYTLTISSLQPEDFATYYCQQGNTLPWTFGQGTKV | ||
| EIKGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCAASGYSFTGYTMNWVRQAPGKGLEWVALI | ||
| NPYKGVSTYNQKFKDRFTISVDKSKNTAYLQMNSLRAEDTAVYYCARSGYYGDSDWYFDVWGQGTLVTV | ||
| SSTSGGGGSLESGQVLLESNIKVLPTWSTPVQPMALIVLGGVAGLLLFIGLGIFFCVRCRHRRRQAERM | ||
| SQIKRLLSEKKTCQCPHRFQKTCSPI | ||
| 108 | Nucleotide | ATGGCTCTGCCTGTGACAGCTCTGTTGCTGCCTCTGGCTCTGCTGCTGCATGCTGCTAGACCTGAGGTG |
| CAGCTGGTTGAATCTGGCGGAGGATTGGTTCAGCCTGGCGGCTCTCTGAGACTGTCTTGTGCCGCCTCT | ||
| CGGAACATCTTCAGCCTGTACAGAGTGGACTGGTACAGACAGGCCCCTGGCAAAGGACTGGAACTGGTG | ||
| GCTGGATCTACCTCTGGCGGCACCACCACCTATGCCGATGCTGTGAAGGGCAGATTCACCATCTCCACC | ||
| GACAACGTGAAGGACACCCTGTACCTGCAGATGAACTCCCTGAGAGCCGAGGACACCGCCGTGTACTAC | ||
| TGTCACGCTCACGATCACTGGCGGGACTCTTGGGGACAGGGAACACTGGTCACAGTGTCCTCTGAGCAG | ||
| AAACTGATCAGCGAGGAAGATCTGAATCCTGGCGGCGGTGGAGGCAGCGGAGGTGGCGGGAGTGGCGGA | ||
| GGCGGTTCAGGGGGTGGAGGCTCTGGATCTATGGATATCCAGATGACCCAGTCCCCGAGCTCCCTGTCC | ||
| GCCTCTGTGGGCGATAGGGTCACCATCACCTGCCGTGCCAGTCAGGACATCCGTAATTATCTGAACTGG | ||
| TATCAACAGAAACCAGGAAAAGCTCCGAAACTACTGATTTACTATACCTCCCGCCTGGAGTCTGGAGTC | ||
| CCTTCTCGCTTCTCTGGTTCTGGTTCTGGGACGGATTACACTCTGACCATCAGCAGTCTGCAACCGGAA | ||
| GACTTCGCAACTTATTACTGTCAGCAAGGTAATACTCTGCCGTGGACGTTCGGACAGGGCACCAAGGTG | ||
| GAGATCAAAGGCGGCGGCGGAAGTGGAGGAGGAGGCTCAGGCGGAGGAGGGAGCGAGGTTCAGCTGGTG | ||
| GAGTCTGGCGGTGGCCTGGTGCAGCCAGGGGGCTCACTCCGTTTGTCCTGTGCAGCTTCTGGCTACTCC | ||
| TTTACCGGCTACACTATGAACTGGGTGCGTCAGGCCCCAGGTAAGGGCCTGGAATGGGTTGCACTGATT | ||
| AATCCTTATAAAGGTGTTAGTACCTACAACCAGAAGTTCAAGGACCGTTTCACTATAAGCGTAGATAAA | ||
| TCCAAAAACACAGCCTACCTGCAAATGAACAGCCTGCGTGCTGAGGACACTGCCGTCTATTATTGTGCT | ||
| AGAAGCGGATACTACGGCGATAGTGACTGGTATTTTGACGTGTGGGGTCAAGGAACCCTGGTCACCGTC | ||
| TCCTCGACATCTGGCGGCGGAGGATCTCTGGAATCTGGACAGGTGCTGCTGGAAAGCAACATCAAGGTG | ||
| CTGCCCACCTGGTCTACCCCAGTTCAGCCTATGGCTCTGATTGTGCTTGGCGGAGTTGCCGGCCTGCTG | ||
| CTCTTTATCGGCCTGGGCATCTTCTTTTGCGTGCGGTGCAGACATCGGCGGAGACAGGCTGAGAGAATG | ||
| AGCCAGATCAAGCGGCTGCTGAGCGAGAAGAAAACCTGTCAGTGCCCTCACCGGTTCCAGAAAACATGC | ||
| AGCCCCATC | ||
| 109 | Amino Acid | MALPVTALLLPLALLLHAARPEVQLVESGGGLVQPGGSLRLSCAASRNIFSLYRVDWYRQAPGKGLELV |
| AGSTSGGTTTYADAVKGRFTISTDNVKDTLYLQMNSLRAEDTAVYYCHAHDHWRDSWGQGTLVTVSSEQ | ||
| KLISEEDLNPGGGGGSGGGGSGGGGSGGGGSGSMDIQMTQSPSSLSASVGDRVTITCRASQDIRNYLNW | ||
| YQQKPGKAPKLLIYYTSRLESGVPSRFSGSGSGTDYTLTISSLQPEDFATYYCQQGNTLPWTFGQGTKV | ||
| EIKGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCAASGYSFTGYTMNWVRQAPGKGLEWVALI | ||
| NPYKGVSTYNQKFKDRFTISVDKSKNTAYLQMNSLRAEDTAVYYCARSGYYGDSDWYFDVWGQGTLVTV | ||
| SSTSGGGGSLESGQVLLESNIKVLPTWSTPVQPMALIVLGGVAGLLLFIGLGIFFCVRCRHRRRQAERM | ||
| SQIKRLLSEKKTCQCPHRFQKTCSPI | ||
| 110 | Nucleotide | ATGGCTCTGCCTGTGACAGCTCTGTTGCTGCCTCTGGCTCTGCTGCTGCATGCTGCTAGACCTGAGGTG |
| CAGCTGGTTGAATCTGGCGGAGGATTGGTTCAGCCTGGCGGCTCTCTGAGACTGTCTTGTGCCGCCTCT | ||
| CGGAACATCTTCAGCCTGTACAGAGTGGACTGGGTCCGACAGGCTCCTGGCAAACAGAGAGAACTGGTC | ||
| GCCGGCTCTACCTCTGGCGGCACCACAACTTATGCCGACGCTGTGAAGGGCAGATTCACCATCTCTCGG | ||
| GACAACGTGAAGAACACCCTGTACCTGCAGATGAACTCCCTGAGAGCCGAGGACACCGCCGTGTACTAC | ||
| TGTCACGCTCACGATCACTGGCGGGACTCTTGGGGACAGGGAACACTGGTCACAGTGTCCTCTGAGCAG | ||
| AAACTGATCAGCGAGGAAGATCTGAATCCTGGCGGCGGTGGAGGCAGCGGAGGTGGCGGGAGTGGCGGA | ||
| GGCGGTTCAGGGGGTGGAGGCTCTGGATCTATGGATATCCAGATGACCCAGTCCCCGAGCTCCCTGTCC | ||
| GCCTCTGTGGGCGATAGGGTCACCATCACCTGCCGTGCCAGTCAGGACATCCGTAATTATCTGAACTGG | ||
| TATCAACAGAAACCAGGAAAAGCTCCGAAACTACTGATTTACTATACCTCCCGCCTGGAGTCTGGAGTC | ||
| CCTTCTCGCTTCTCTGGTTCTGGTTCTGGGACGGATTACACTCTGACCATCAGCAGTCTGCAACCGGAA | ||
| GACTTCGCAACTTATTACTGTCAGCAAGGTAATACTCTGCCGTGGACGTTCGGACAGGGCACCAAGGTG | ||
| GAGATCAAAGGCGGCGGCGGAAGTGGAGGAGGAGGCTCAGGCGGAGGAGGGAGCGAGGTTCAGCTGGTG | ||
| GAGTCTGGCGGTGGCCTGGTGCAGCCAGGGGGCTCACTCCGTTTGTCCTGTGCAGCTTCTGGCTACTCC | ||
| TTTACCGGCTACACTATGAACTGGGTGCGTCAGGCCCCAGGTAAGGGCCTGGAATGGGTTGCACTGATT | ||
| AATCCTTATAAAGGTGTTAGTACCTACAACCAGAAGTTCAAGGACCGTTTCACTATAAGCGTAGATAAA | ||
| TCCAAAAACACAGCCTACCTGCAAATGAACAGCCTGCGTGCTGAGGACACTGCCGTCTATTATTGTGCT | ||
| AGAAGCGGATACTACGGCGATAGTGACTGGTATTTTGACGTGTGGGGTCAAGGAACCCTGGTCACCGTC | ||
| TCCTCGACATCTGGCGGCGGAGGATCTCTGGAATCTGGACAGGTGCTGCTGGAAAGCAACATCAAGGTG | ||
| CTGCCCACCTGGTCTACCCCAGTTCAGCCTATGGCTCTGATTGTGCTTGGCGGAGTTGCCGGCCTGCTG | ||
| CTCTTTATCGGCCTGGGCATCTTCTTTTGCGTGCGGTGCAGACATCGGCGGAGACAGGCTGAGAGAATG | ||
| AGCCAGATCAAGCGGCTGCTGAGCGAGAAGAAAACCTGTCAGTGCCCTCACCGGTTCCAGAAAACATGC | ||
| AGCCCCATC | ||
| 111 | Amino Acid | MALPVTALLLPLALLLHAARPEVQLVESGGGLVQPGGSLRLSCAASRNIFSLYRVDWVRQAPGKQRELV |
| AGSTSGGTTTYADAVKGRFTISRDNVKNTLYLQMNSLRAEDTAVYYCHAHDHWRDSWGQGTLVTVSSEQ | ||
| KLISEEDLNPGGGGGSGGGGSGGGGSGGGGSGSMDIQMTQSPSSLSASVGDRVTITCRASQDIRNYLNW | ||
| YQQKPGKAPKLLIYYTSRLESGVPSRFSGSGSGTDYTLTISSLQPEDFATYYCQQGNTLPWTFGQGTKV | ||
| EIKGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCAASGYSFTGYTMNWVRQAPGKGLEWVALI | ||
| NPYKGVSTYNQKFKDRFTISVDKSKNTAYLQMNSLRAEDTAVYYCARSGYYGDSDWYFDVWGQGTLVTV | ||
| SSTSGGGGSLESGQVLLESNIKVLPTWSTPVQPMALIVLGGVAGLLLFIGLGIFFCVRCRHRRRQAERM | ||
| SQIKRLLSEKKTCQCPHRFQKTCSPI | ||
| 112 | Nucleotide | ATGGCTCTGCCTGTGACAGCTCTGTTGCTGCCTCTGGCTCTGCTGCTGCATGCTGCTAGACCTGAGGTG |
| CAGCTGGTTGAATCTGGCGGAGGATTGGTTCAGCCTGGCGGCTCTCTGAGACTGTCTTGTGCCGCCTCT | ||
| CGGAACATCTTCAGCCTGTACAGAGTGGACTGGTACAGACAGGCCCCTGGCAAAGGACTGGAACTGGTG | ||
| GCTGGATCTACCTCTGGCGGCACCACCACCTATGCCGATGCTGTGAAGGGCAGATTCACCATCAGCCGG | ||
| GACAACGTGAAGAACACCCTGTACCTGCAGATGAACTCCCTGAGAGCCGAGGACACCGCCGTGTACTAC | ||
| TGTCACGCTCACGATCACTGGCGGGACTCTTGGGGACAGGGAACACTGGTCACAGTGTCCTCTGAGCAG | ||
| AAACTGATCAGCGAGGAAGATCTGAATCCTGGCGGCGGTGGAGGCAGCGGAGGTGGCGGGAGTGGCGGA | ||
| GGCGGTTCAGGGGGTGGAGGCTCTGGATCTATGGATATCCAGATGACCCAGTCCCCGAGCTCCCTGTCC | ||
| GCCTCTGTGGGCGATAGGGTCACCATCACCTGCCGTGCCAGTCAGGACATCCGTAATTATCTGAACTGG | ||
| TATCAACAGAAACCAGGAAAAGCTCCGAAACTACTGATTTACTATACCTCCCGCCTGGAGTCTGGAGTC | ||
| CCTTCTCGCTTCTCTGGTTCTGGTTCTGGGACGGATTACACTCTGACCATCAGCAGTCTGCAACCGGAA | ||
| GACTTCGCAACTTATTACTGTCAGCAAGGTAATACTCTGCCGTGGACGTTCGGACAGGGCACCAAGGTG | ||
| GAGATCAAAGGCGGCGGCGGAAGTGGAGGAGGAGGCTCAGGCGGAGGAGGGAGCGAGGTTCAGCTGGTG | ||
| GAGTCTGGCGGTGGCCTGGTGCAGCCAGGGGGCTCACTCCGTTTGTCCTGTGCAGCTTCTGGCTACTCC | ||
| TTTACCGGCTACACTATGAACTGGGTGCGTCAGGCCCCAGGTAAGGGCCTGGAATGGGTTGCACTGATT | ||
| AATCCTTATAAAGGTGTTAGTACCTACAACCAGAAGTTCAAGGACCGTTTCACTATAAGCGTAGATAAA | ||
| TCCAAAAACACAGCCTACCTGCAAATGAACAGCCTGCGTGCTGAGGACACTGCCGTCTATTATTGTGCT | ||
| AGAAGCGGATACTACGGCGATAGTGACTGGTATTTTGACGTGTGGGGTCAAGGAACCCTGGTCACCGTC | ||
| TCCTCGACATCTGGCGGCGGAGGATCTCTGGAATCTGGACAGGTGCTGCTGGAAAGCAACATCAAGGTG | ||
| CTGCCCACCTGGTCTACCCCAGTTCAGCCTATGGCTCTGATTGTGCTTGGCGGAGTTGCCGGCCTGCTG | ||
| CTCTTTATCGGCCTGGGCATCTTCTTTTGCGTGCGGTGCAGACATCGGCGGAGACAGGCTGAGAGAATG | ||
| AGCCAGATCAAGCGGCTGCTGAGCGAGAAGAAAACCTGTCAGTGCCCTCACCGGTTCCAGAAAACATGC | ||
| AGCCCCATC | ||
| 113 | Amino Acid | MALPVTALLLPLALLLHAARPEVQLVESGGGLVQPGGSLRLSCAASRNIFSLYRVDWYRQAPGKGLELV |
| AGSTSGGTTTYADAVKGRFTISRDNVKNTLYLQMNSLRAEDTAVYYCHAHDHWRDSWGQGTLVTVSSEQ | ||
| KLISEEDLNPGGGGGSGGGGSGGGGSGGGGSGSMDIQMTQSPSSLSASVGDRVTITCRASQDIRNYLNW | ||
| YQQKPGKAPKLLIYYTSRLESGVPSRFSGSGSGTDYTLTISSLQPEDFATYYCQQGNTLPWTFGQGTKV | ||
| EIKGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCAASGYSFTGYTMNWVRQAPGKGLEWVALI | ||
| NPYKGVSTYNQKFKDRFTISVDKSKNTAYLQMNSLRAEDTAVYYCARSGYYGDSDWYFDVWGQGTLVTV | ||
| SSTSGGGGSLESGQVLLESNIKVLPTWSTPVQPMALIVLGGVAGLLLFIGLGIFFCVRCRHRRRQAERM | ||
| SQIKRLLSEKKTCQCPHRFQKTCSPI | ||
| 114 | Nucleotide | ATGGCTCTGCCTGTGACAGCTCTGTTGCTGCCTCTGGCTCTGCTGCTGCATGCTGCTAGACCTGAGGTG |
| CAGCTGGTTGAATCTGGCGGAGGATTGGTTCAGCCTGGCGGCTCTCTGAGACTGTCTTGTGCCGCCTCT | ||
| CGGAACATCTTCAGCCTGTACAGAGTGGACTGGGTCCGACAGGCTCCTGGCAAAGGACTGGAACTGGTG | ||
| GCTGGCTCTACCTCTGGCGGCACCACAACCTATGCCGATGCTGTGAAGGGCAGATTCACCATCAGCCGG | ||
| GACAACGTGAAGAACACCCTGTACCTGCAGATGAACTCCCTGAGAGCCGAGGACACCGCCGTGTACTAC | ||
| TGTCACGCTCACGATCACTGGCGGGACTCTTGGGGACAGGGAACACTGGTCACAGTGTCCTCTGAGCAG | ||
| AAACTGATCAGCGAGGAAGATCTGAATCCTGGCGGCGGTGGAGGCAGCGGAGGTGGCGGGAGTGGCGGA | ||
| GGCGGTTCAGGGGGTGGAGGCTCTGGATCTATGGATATCCAGATGACCCAGTCCCCGAGCTCCCTGTCC | ||
| GCCTCTGTGGGCGATAGGGTCACCATCACCTGCCGTGCCAGTCAGGACATCCGTAATTATCTGAACTGG | ||
| TATCAACAGAAACCAGGAAAAGCTCCGAAACTACTGATTTACTATACCTCCCGCCTGGAGTCTGGAGTC | ||
| CCTTCTCGCTTCTCTGGTTCTGGTTCTGGGACGGATTACACTCTGACCATCAGCAGTCTGCAACCGGAA | ||
| GACTTCGCAACTTATTACTGTCAGCAAGGTAATACTCTGCCGTGGACGTTCGGACAGGGCACCAAGGTG | ||
| GAGATCAAAGGCGGCGGCGGAAGTGGAGGAGGAGGCTCAGGCGGAGGAGGGAGCGAGGTTCAGCTGGTG | ||
| GAGTCTGGCGGTGGCCTGGTGCAGCCAGGGGGCTCACTCCGTTTGTCCTGTGCAGCTTCTGGCTACTCC | ||
| TTTACCGGCTACACTATGAACTGGGTGCGTCAGGCCCCAGGTAAGGGCCTGGAATGGGTTGCACTGATT | ||
| AATCCTTATAAAGGTGTTAGTACCTACAACCAGAAGTTCAAGGACCGTTTCACTATAAGCGTAGATAAA | ||
| TCCAAAAACACAGCCTACCTGCAAATGAACAGCCTGCGTGCTGAGGACACTGCCGTCTATTATTGTGCT | ||
| AGAAGCGGATACTACGGCGATAGTGACTGGTATTTTGACGTGTGGGGTCAAGGAACCCTGGTCACCGTC | ||
| TCCTCGACATCTGGCGGCGGAGGATCTCTGGAATCTGGACAGGTGCTGCTGGAAAGCAACATCAAGGTG | ||
| CTGCCCACCTGGTCTACCCCAGTTCAGCCTATGGCTCTGATTGTGCTTGGCGGAGTTGCCGGCCTGCTG | ||
| CTCTTTATCGGCCTGGGCATCTTCTTTTGCGTGCGGTGCAGACATCGGCGGAGACAGGCTGAGAGAATG | ||
| AGCCAGATCAAGCGGCTGCTGAGCGAGAAGAAAACCTGTCAGTGCCCTCACCGGTTCCAGAAAACATGC | ||
| AGCCCCATC | ||
| 115 | Amino Acid | MALPVTALLLPLALLLHAARPEVQLVESGGGLVQPGGSLRLSCAASRNIFSLYRVDWVRQAPGKGLELV |
| AGSTSGGTTTYADAVKGRFTISRDNVKNTLYLQMNSLRAEDTAVYYCHAHDHWRDSWGQGTLVTVSSEQ | ||
| KLISEEDLNPGGGGGSGGGGSGGGGSGGGGSGSMDIQMTQSPSSLSASVGDRVTITCRASQDIRNYLNW | ||
| YQQKPGKAPKLLIYYTSRLESGVPSRFSGSGSGTDYTLTISSLQPEDFATYYCQQGNTLPWTFGQGTKV | ||
| EIKGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCAASGYSFTGYTMNWVRQAPGKGLEWVALI | ||
| NPYKGVSTYNQKFKDRFTISVDKSKNTAYLQMNSLRAEDTAVYYCARSGYYGDSDWYFDVWGQGTLVTV | ||
| SSTSGGGGSLESGQVLLESNIKVLPTWSTPVQPMALIVLGGVAGLLLFIGLGIFFCVRCRHRRRQAERM | ||
| SQIKRLLSEKKTCQCPHRFQKTCSPI | ||
| 116 | Nucleotide | ATGGCTCTGCCTGTGACAGCTCTGTTGCTGCCTCTGGCTCTGCTGCTGCATGCTGCTAGACCTCAGGTG |
| CAGCTGGTTGAATCTGGCGGAGGATTGGTTCAGCCTGGCGGCTCTCTGAGACTGTCTTGCGCCGTGTCT | ||
| CGGAATATCGCCAGCCTGTACAGAGTGGACTGGTACAGACAGGCCCCTGGCAAGCAGAGAGAGCTGGTC | ||
| GCTGGAAGAACCTCTGGCGGCACCACCACCTATCTGGATGCTGTGGAAGGCCGGTTCACCATCTCTCGG | ||
| GACAACGTGAAGGACACCCTGTACCTGCAGATGAACTCTCTGACCCCTGAGGACACCGCCGTGTACTAC | ||
| TGTCACGCTCACGATCACTGGCGGGACTCTTGGGGACAGGGAACACTGGTCACAGTGTCCTCTGAGCAG | ||
| AAACTGATCAGCGAGGAAGATCTGAATCCTGGCGGCGGTGGAGGCAGCGGAGGTGGCGGGAGTGGCGGA | ||
| GGCGGTTCAGGGGGTGGAGGCTCTGGATCTATGGATATCCAGATGACCCAGTCCCCGAGCTCCCTGTCC | ||
| GCCTCTGTGGGCGATAGGGTCACCATCACCTGCCGTGCCAGTCAGGACATCCGTAATTATCTGAACTGG | ||
| TATCAACAGAAACCAGGAAAAGCTCCGAAACTACTGATTTACTATACCTCCCGCCTGGAGTCTGGAGTC | ||
| CCTTCTCGCTTCTCTGGTTCTGGTTCTGGGACGGATTACACTCTGACCATCAGCAGTCTGCAACCGGAA | ||
| GACTTCGCAACTTATTACTGTCAGCAAGGTAATACTCTGCCGTGGACGTTCGGACAGGGCACCAAGGTG | ||
| GAGATCAAAGGCGGCGGCGGAAGTGGAGGAGGAGGCTCAGGCGGAGGAGGGAGCGAGGTTCAGCTGGTG | ||
| GAGTCTGGCGGTGGCCTGGTGCAGCCAGGGGGCTCACTCCGTTTGTCCTGTGCAGCTTCTGGCTACTCC | ||
| TTTACCGGCTACACTATGAACTGGGTGCGTCAGGCCCCAGGTAAGGGCCTGGAATGGGTTGCACTGATT | ||
| AATCCTACCAAAGGTGTTAGTACCTACAACCAGAAGTTCAAGGACCGTTTCACTATAAGCGTAGATAAA | ||
| TCCAAAAACACAGCCTACCTGCAAATGAACAGCCTGCGTGCTGAGGACACTGCCGTCTATTATTGTGCT | ||
| AGAAGCGGATACTACGGCGATAGTGACTGGTATTTTGACGTGTGGGGTCAAGGAACCCTGGTCACCGTC | ||
| TCCTCGACATCTGGCGGCGGAGGATCTCTGGAATCTGGACAGGTGCTGCTGGAAAGCAACATCAAGGTG | ||
| CTGCCCACCTGGTCTACCCCAGTTCAGCCTATGGCTCTGATTGTGCTTGGCGGAGTTGCCGGCCTGCTG | ||
| CTCTTTATCGGCCTGGGCATCTTCTTTTGCGTGCGGTGCAGACATCGGCGGAGACAGGCTGAGAGAATG | ||
| AGCCAGATCAAGCGGCTGCTGAGCGAGAAGAAAACCTGTCAGTGCCCTCACCGGTTCCAGAAAACATGC | ||
| AGCCCCATC | ||
| 117 | Amino Acid | MALPVTALLLPLALLLHAARPQVQLVESGGGLVQPGGSLRLSCAVSRNIASLYRVDWYRQAPGKQRELV |
| AGRTSGGTTTYLDAVEGRFTISRDNVKDTLYLQMNSLTPEDTAVYYCHAHDHWRDSWGQGTLVTVSSEQ | ||
| KLISEEDLNPGGGGGSGGGGSGGGGSGGGGSGSMDIQMTQSPSSLSASVGDRVTITCRASQDIRNYLNW | ||
| YQQKPGKAPKLLIYYTSRLESGVPSRESGSGSGTDYTLTISSLQPEDFATYYCQQGNTLPWTFGQGTKV | ||
| EIKGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCAASGYSFTGYTMNWVRQAPGKGLEWVALI | ||
| NPTKGVSTYNQKFKDRFTISVDKSKNTAYLQMNSLRAEDTAVYYCARSGYYGDSDWYFDVWGQGTLVTV | ||
| SSTSGGGGSLESGQVLLESNIKVLPTWSTPVQPMALIVLGGVAGLLLFIGLGIFFCVRCRHRRRQAERM | ||
| SQIKRLLSEKKTCQCPHRFQKTCSPI | ||
| 118 | Nucleotide | ATGGCTCTGCCTGTGACAGCTCTGTTGCTGCCTCTGGCTCTGCTGCTGCATGCTGCTAGACCTCAGGTG |
| CAGCTGGTTGAATCTGGCGGAGGATTGGTTCAGCCTGGCGGCTCTCTGAGACTGTCTTGCGCCGTGTCT | ||
| CGGAATATCGCCAGCCTGTACAGAGTGGACTGGTACAGACAGGCCCCTGGCAAGCAGAGAGAGCTGGTC | ||
| GCTGGAAGAACCTCTGGCGGCACCACCACCTATCTGGATGCTGTGGAAGGCCGGTTCACCATCTCTCGG | ||
| GACAACGTGAAGAACACCCTGTACCTGCAGATGAACTCTCTGACCCCTGAGGACACCGCCGTGTACTAC | ||
| TGTCACGCTCACGATCACTGGCGGGACTCTTGGGGACAGGGAACACTGGTCACAGTGTCCTCTGAGCAG | ||
| AAACTGATCAGCGAGGAAGATCTGAATCCTGGCGGCGGTGGAGGCAGCGGAGGTGGCGGGAGTGGCGGA | ||
| GGCGGTTCAGGGGGTGGAGGCTCTGGATCTATGGATATCCAGATGACCCAGTCCCCGAGCTCCCTGTCC | ||
| GCCTCTGTGGGCGATAGGGTCACCATCACCTGCCGTGCCAGTCAGGACATCCGTAATTATCTGAACTGG | ||
| TATCAACAGAAACCAGGAAAAGCTCCGAAACTACTGATTTACTATACCTCCCGCCTGGAGTCTGGAGTC | ||
| CCTTCTCGCTTCTCTGGTTCTGGTTCTGGGACGGATTACACTCTGACCATCAGCAGTCTGCAACCGGAA | ||
| GACTTCGCAACTTATTACTGTCAGCAAGGTAATACTCTGCCGTGGACGTTCGGACAGGGCACCAAGGTG | ||
| GAGATCAAAGGCGGCGGCGGAAGTGGAGGAGGAGGCTCAGGCGGAGGAGGGAGCGAGGTTCAGCTGGTG | ||
| GAGTCTGGCGGTGGCCTGGTGCAGCCAGGGGGCTCACTCCGTTTGTCCTGTGCAGCTTCTGGCTACTCC | ||
| TTTACCGGCTACACTATGAACTGGGTGCGTCAGGCCCCAGGTAAGGGCCTGGAATGGGTTGCACTGATT | ||
| AATCCTACCAAAGGTGTTAGTACCTACAACCAGAAGTTCAAGGACCGTTTCACTATAAGCGTAGATAAA | ||
| TCCAAAAACACAGCCTACCTGCAAATGAACAGCCTGCGTGCTGAGGACACTGCCGTCTATTATTGTGCT | ||
| AGAAGCGGATACTACGGCGATAGTGACTGGTATTTTGACGTGTGGGGTCAAGGAACCCTGGTCACCGTC | ||
| TCCTCGACATCTGGCGGCGGAGGATCTCTGGAATCTGGACAGGTGCTGCTGGAAAGCAACATCAAGGTG | ||
| CTGCCCACCTGGTCTACCCCAGTTCAGCCTATGGCTCTGATTGTGCTTGGCGGAGTTGCCGGCCTGCTG | ||
| CTCTTTATCGGCCTGGGCATCTTCTTTTGCGTGCGGTGCAGACATCGGCGGAGACAGGCTGAGAGAATG | ||
| AGCCAGATCAAGCGGCTGCTGAGCGAGAAGAAAACCTGTCAGTGCCCTCACCGGTTCCAGAAAACATGC | ||
| AGCCCCATC | ||
| 119 | Amino Acid | MALPVTALLLPLALLLHAARPQVQLVESGGGLVQPGGSLRLSCAVSRNIASLYRVDWYRQAPGKQRELV |
| AGRTSGGTTTYLDAVEGRFTISRDNVKNTLYLQMNSLTPEDTAVYYCHAHDHWRDSWGQGTLVTVSSEQ | ||
| KLISEEDLNPGGGGGSGGGGSGGGGSGGGGSGSMDIQMTQSPSSLSASVGDRVTITCRASQDIRNYLNW | ||
| YQQKPGKAPKLLIYYTSRLESGVPSRFSGSGSGTDYTLTISSLQPEDFATYYCQQGNTLPWTFGQGTKV | ||
| EIKGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCAASGYSFTGYTMNWVRQAPGKGLEWVALI | ||
| NPTKGVSTYNQKFKDRFTISVDKSKNTAYLQMNSLRAEDTAVYYCARSGYYGDSDWYFDVWGQGTLVTV | ||
| SSTSGGGGSLESGQVLLESNIKVLPTWSTPVQPMALIVLGGVAGLLLFIGLGIFFCVRCRHRRRQAERM | ||
| SQIKRLLSEKKTCQCPHRFQKTCSPI | ||
| 120 | Nucleotide | ATGGCTCTGCCTGTGACAGCTCTGTTGCTGCCTCTGGCTCTGCTGCTGCATGCTGCTAGACCTCAGGTG |
| CAGCTGGTTGAATCTGGCGGAGGATTGGTTCAGCCTGGCGGCTCTCTGAGACTGTCTTGCGCCGTGTCT | ||
| CGGAATATCGCCAGCCTGTACAGAGTGGACTGGTACAGACAGGCCCCTGGCAAGCAGAGAGAGCTGGTC | ||
| GCTGGAAGAACCTCTGGCGGCACCACCACCTATCTGGATGCTGTGGAAGGCCGGTTCACCATCTCTCGG | ||
| GACAACGTGAAGAACACCCTGTACCTGCAGATGAACTCCCTGAGAGCCGAGGACACCGCCGTGTACTAC | ||
| TGTCACGCTCACGATCACTGGCGGGACTCTTGGGGACAGGGCACACAAGTGACAGTGTCCTCTGAGCAG | ||
| AAACTGATCAGCGAGGAAGATCTGAATCCTGGCGGCGGTGGAGGCAGCGGAGGTGGCGGGAGTGGCGGA | ||
| GGCGGTTCAGGGGGTGGAGGCTCTGGATCTATGGATATCCAGATGACCCAGTCCCCGAGCTCCCTGTCC | ||
| GCCTCTGTGGGCGATAGGGTCACCATCACCTGCCGTGCCAGTCAGGACATCCGTAATTATCTGAACTGG | ||
| TATCAACAGAAACCAGGAAAAGCTCCGAAACTACTGATTTACTATACCTCCCGCCTGGAGTCTGGAGTC | ||
| CCTTCTCGCTTCTCTGGTTCTGGTTCTGGGACGGATTACACTCTGACCATCAGCAGTCTGCAACCGGAA | ||
| GACTTCGCAACTTATTACTGTCAGCAAGGTAATACTCTGCCGTGGACGTTCGGACAGGGCACCAAGGTG | ||
| GAGATCAAAGGCGGCGGCGGAAGTGGAGGAGGAGGCTCAGGCGGAGGAGGGAGCGAGGTTCAGCTGGTG | ||
| GAGTCTGGCGGTGGCCTGGTGCAGCCAGGGGGCTCACTCCGTTTGTCCTGTGCAGCTTCTGGCTACTCC | ||
| TTTACCGGCTACACTATGAACTGGGTGCGTCAGGCCCCAGGTAAGGGCCTGGAATGGGTTGCACTGATT | ||
| AATCCTACCAAAGGTGTTAGTACCTACAACCAGAAGTTCAAGGACCGTTTCACTATAAGCGTAGATAAA | ||
| TCCAAAAACACAGCCTACCTGCAAATGAACAGCCTGCGTGCTGAGGACACTGCCGTCTATTATTGTGCT | ||
| AGAAGCGGATACTACGGCGATAGTGACTGGTATTTTGACGTGTGGGGTCAAGGAACCCTGGTCACCGTC | ||
| TCCTCGACATCTGGCGGCGGAGGATCTCTGGAATCTGGACAGGTGCTGCTGGAAAGCAACATCAAGGTG | ||
| CTGCCCACCTGGTCTACCCCAGTTCAGCCTATGGCTCTGATTGTGCTTGGCGGAGTTGCCGGCCTGCTG | ||
| CTCTTTATCGGCCTGGGCATCTTCTTTTGCGTGCGGTGCAGACATCGGCGGAGACAGGCTGAGAGAATG | ||
| AGCCAGATCAAGCGGCTGCTGAGCGAGAAGAAAACCTGTCAGTGCCCTCACCGGTTCCAGAAAACATGC | ||
| AGCCCCATC | ||
| 121 | Amino Acid | MALPVTALLLPLALLLHAARPQVQLVESGGGLVQPGGSLRLSCAVSRNIASLYRVDWYRQAPGKQRELV |
| AGRTSGGTTTYLDAVEGRFTISRDNVKNTLYLQMNSLRAEDTAVYYCHAHDHWRDSWGQGTQVTVSSEQ | ||
| KLISEEDLNPGGGGGSGGGGSGGGGSGGGGSGSMDIQMTQSPSSLSASVGDRVTITCRASQDIRNYLNW | ||
| YQQKPGKAPKLLIYYTSRLESGVPSRFSGSGSGTDYTLTISSLQPEDFATYYCQQGNTLPWTFGQGTKV | ||
| EIKGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCAASGYSFTGYTMNWVRQAPGKGLEWVALI | ||
| NPTKGVSTYNQKFKDRFTISVDKSKNTAYLQMNSLRAEDTAVYYCARSGYYGDSDWYFDVWGQGTLVTV | ||
| SSTSGGGGSLESGQVLLESNIKVLPTWSTPVQPMALIVLGGVAGLLLFIGLGIFFCVRCRHRRRQAERM | ||
| SQIKRLLSEKKTCQCPHRFQKTCSPI | ||
| 122 | Nucleotide | ATGGCTCTGCCTGTGACAGCTCTGTTGCTGCCTCTGGCTCTGCTGCTGCATGCTGCTAGACCTCAGGTG |
| CAGCTGGTTGAATCTGGCGGAGGATTGGTTCAGCCTGGCGGCTCTCTGAGACTGTCTTGTGCCGCCTCT | ||
| CGGAATATCGCCAGCCTGTACAGAGTGGACTGGGTCCGACAGGCTCCTGGCAAACAGAGAGAGCTGGTC | ||
| GCTGGCAGAACCTCTGGCGGCACCACCACATATCTGGATGCCGTGGAAGGCCGGTTCACCATCTCCAGA | ||
| GACAACGTGAAGGACACCGTGTACCTGCAGATGAACTCCCTGAGAGCCGAGGACACCGCCGTGTACTAC | ||
| TGTCACGCTCACGATCACTGGCGGGACTCTTGGGGACAGGGAACACTGGTCACAGTGTCCTCTGAGCAG | ||
| AAACTGATCAGCGAGGAAGATCTGAATCCTGGCGGCGGTGGAGGCAGCGGAGGTGGCGGGAGTGGCGGA | ||
| GGCGGTTCAGGGGGTGGAGGCTCTGGATCTATGGATATCCAGATGACCCAGTCCCCGAGCTCCCTGTCC | ||
| GCCTCTGTGGGCGATAGGGTCACCATCACCTGCCGTGCCAGTCAGGACATCCGTAATTATCTGAACTGG | ||
| TATCAACAGAAACCAGGAAAAGCTCCGAAACTACTGATTTACTATACCTCCCGCCTGGAGTCTGGAGTC | ||
| CCTTCTCGCTTCTCTGGTTCTGGTTCTGGGACGGATTACACTCTGACCATCAGCAGTCTGCAACCGGAA | ||
| GACTTCGCAACTTATTACTGTCAGCAAGGTAATACTCTGCCGTGGACGTTCGGACAGGGCACCAAGGTG | ||
| GAGATCAAAGGCGGCGGCGGAAGTGGAGGAGGAGGCTCAGGCGGAGGAGGGAGCGAGGTTCAGCTGGTG | ||
| GAGTCTGGCGGTGGCCTGGTGCAGCCAGGGGGCTCACTCCGTTTGTCCTGTGCAGCTTCTGGCTACTCC | ||
| TTTACCGGCTACACTATGAACTGGGTGCGTCAGGCCCCAGGTAAGGGCCTGGAATGGGTTGCACTGATT | ||
| AATCCTACCAAAGGTGTTAGTACCTACAACCAGAAGTTCAAGGACCGTTTCACTATAAGCGTAGATAAA | ||
| TCCAAAAACACAGCCTACCTGCAAATGAACAGCCTGCGTGCTGAGGACACTGCCGTCTATTATTGTGCT | ||
| AGAAGCGGATACTACGGCGATAGTGACTGGTATTTTGACGTGTGGGGTCAAGGAACCCTGGTCACCGTC | ||
| TCCTCGACATCTGGCGGCGGAGGATCTCTGGAATCTGGACAGGTGCTGCTGGAAAGCAACATCAAGGTG | ||
| CTGCCCACCTGGTCTACCCCAGTTCAGCCTATGGCTCTGATTGTGCTTGGCGGAGTTGCCGGCCTGCTG | ||
| CTCTTTATCGGCCTGGGCATCTTCTTTTGCGTGCGGTGCAGACATCGGCGGAGACAGGCTGAGAGAATG | ||
| AGCCAGATCAAGCGGCTGCTGAGCGAGAAGAAAACCTGTCAGTGCCCTCACCGGTTCCAGAAAACATGC | ||
| AGCCCCATC | ||
| 123 | Amino Acid | MALPVTALLLPLALLLHAARPQVQLVESGGGLVQPGGSLRLSCAASRNIASLYRVDWVRQAPGKQRELV |
| AGRTSGGTTTYLDAVEGRFTISRDNVKDTVYLQMNSLRAEDTAVYYCHAHDHWRDSWGQGTLVTVSSEQ | ||
| KLISEEDLNPGGGGGSGGGGSGGGGSGGGGSGSMDIQMTQSPSSLSASVGDRVTITCRASQDIRNYLNW | ||
| YQQKPGKAPKLLIYYTSRLESGVPSRESGSGSGTDYTLTISSLQPEDFATYYCQQGNTLPWTFGQGTKV | ||
| EIKGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCAASGYSFTGYTMNWVRQAPGKGLEWVALI | ||
| NPTKGVSTYNQKFKDRFTISVDKSKNTAYLQMNSLRAEDTAVYYCARSGYYGDSDWYFDVWGQGTLVTV | ||
| SSTSGGGGSLESGQVLLESNIKVLPTWSTPVQPMALIVLGGVAGLLLFIGLGIFFCVRCRHRRRQAERM | ||
| SQIKRLLSEKKTCQCPHRFQKTCSPI | ||
| 124 | Nucleotide | ATGGCTCTGCCTGTGACAGCTCTGTTGCTGCCTCTGGCTCTGCTGCTGCATGCTGCTAGACCTCAGGTG |
| CAGCTGGTTGAATCTGGCGGAGGATTGGTTCAGCCTGGCGGCTCTCTGAGACTGTCTTGCGCCGTGTCT | ||
| CGGAATATCGCCAGCCTGTACAGAGTGGACTGGTACAGACAGGCCCCTGGCAAAGGACTGGAACTGGTG | ||
| GCTGGAAGAACCTCTGGCGGCACCACCACCTATCTGGATGCTGTGGAAGGCCGGTTCACCATCTCTCGG | ||
| GACAACGTGAAGAACACCGTGTACCTGCAGATGAACTCCCTGAGAGCCGAGGACACCGCCGTGTACTAC | ||
| TGTCACGCTCACGATCACTGGCGGGACTCTTGGGGACAGGGAACACTGGTCACAGTGTCCTCTGAGCAG | ||
| AAACTGATCAGCGAGGAAGATCTGAATCCTGGCGGCGGTGGAGGCAGCGGAGGTGGCGGGAGTGGCGGA | ||
| GGCGGTTCAGGGGGTGGAGGCTCTGGATCTATGGATATCCAGATGACCCAGTCCCCGAGCTCCCTGTCC | ||
| GCCTCTGTGGGCGATAGGGTCACCATCACCTGCCGTGCCAGTCAGGACATCCGTAATTATCTGAACTGG | ||
| TATCAACAGAAACCAGGAAAAGCTCCGAAACTACTGATTTACTATACCTCCCGCCTGGAGTCTGGAGTC | ||
| CCTTCTCGCTTCTCTGGTTCTGGTTCTGGGACGGATTACACTCTGACCATCAGCAGTCTGCAACCGGAA | ||
| GACTTCGCAACTTATTACTGTCAGCAAGGTAATACTCTGCCGTGGACGTTCGGACAGGGCACCAAGGTG | ||
| GAGATCAAAGGCGGCGGCGGAAGTGGAGGAGGAGGCTCAGGCGGAGGAGGGAGCGAGGTTCAGCTGGTG | ||
| GAGTCTGGCGGTGGCCTGGTGCAGCCAGGGGGCTCACTCCGTTTGTCCTGTGCAGCTTCTGGCTACTCC | ||
| TTTACCGGCTACACTATGAACTGGGTGCGTCAGGCCCCAGGTAAGGGCCTGGAATGGGTTGCACTGATT | ||
| AATCCTACCAAAGGTGTTAGTACCTACAACCAGAAGTTCAAGGACCGTTTCACTATAAGCGTAGATAAA | ||
| TCCAAAAACACAGCCTACCTGCAAATGAACAGCCTGCGTGCTGAGGACACTGCCGTCTATTATTGTGCT | ||
| AGAAGCGGATACTACGGCGATAGTGACTGGTATTTTGACGTGTGGGGTCAAGGAACCCTGGTCACCGTC | ||
| TCCTCGACATCTGGCGGCGGAGGATCTCTGGAATCTGGACAGGTGCTGCTGGAAAGCAACATCAAGGTG | ||
| CTGCCCACCTGGTCTACCCCAGTTCAGCCTATGGCTCTGATTGTGCTTGGCGGAGTTGCCGGCCTGCTG | ||
| CTCTTTATCGGCCTGGGCATCTTCTTTTGCGTGCGGTGCAGACATCGGCGGAGACAGGCTGAGAGAATG | ||
| AGCCAGATCAAGCGGCTGCTGAGCGAGAAGAAAACCTGTCAGTGCCCTCACCGGTTCCAGAAAACATGC | ||
| AGCCCCATC | ||
| 125 | Amino Acid | MALPVTALLLPLALLLHAARPQVQLVESGGGLVQPGGSLRLSCAVSRNIASLYRVDWYRQAPGKGLELV |
| AGRTSGGTTTYLDAVEGRFTISRDNVKNTVYLQMNSLRAEDTAVYYCHAHDHWRDSWGQGTLVTVSSEQ | ||
| KLISEEDLNPGGGGGSGGGGSGGGGSGGGGSGSMDIQMTQSPSSLSASVGDRVTITCRASQDIRNYLNW | ||
| YQQKPGKAPKLLIYYTSRLESGVPSRFSGSGSGTDYTLTISSLQPEDFATYYCQQGNTLPWTFGQGTKV | ||
| EIKGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCAASGYSFTGYTMNWVRQAPGKGLEWVALI | ||
| NPTKGVSTYNQKFKDRFTISVDKSKNTAYLQMNSLRAEDTAVYYCARSGYYGDSDWYFDVWGQGTLVTV | ||
| SSTSGGGGSLESGQVLLESNIKVLPTWSTPVQPMALIVLGGVAGLLLFIGLGIFFCVRCRHRRRQAERM | ||
| SQIKRLLSEKKTCQCPHRFQKTCSPI | ||
| 126 | Nucleotide | ATGGCTCTGCCTGTGACAGCTCTGTTGCTGCCTCTGGCTCTGCTGCTGCATGCTGCTAGACCTCAGGTG |
| CAGCTGGTTGAATCTGGCGGAGGATTGGTTCAGCCTGGCGGCTCTCTGAGACTGTCTTGTGCCGCCTCT | ||
| CGGAATATCGCCAGCCTGTACAGAGTGGACTGGTACAGACAGGCCCCTGGCAAGGGAAGAGAACTGGTG | ||
| GCTGGAAGAACCTCTGGCGGCACCACCACCTATCTGGATGCTGTGGAAGGCCGGTTCACCATCTCTCGG | ||
| GACAACGTGAAGGACACCCTGTACCTGCAGATGAACTCCCTGAGAGCCGAGGACACCGCCGTGTACTAC | ||
| TGTCACGCTCACGATCACTGGCGGGACTCTTGGGGACAGGGAACACTGGTCACAGTGTCCTCTGAGCAG | ||
| AAACTGATCAGCGAGGAAGATCTGAATCCTGGCGGCGGTGGAGGCAGCGGAGGTGGCGGGAGTGGCGGA | ||
| GGCGGTTCAGGGGGTGGAGGCTCTGGATCTATGGATATCCAGATGACCCAGTCCCCGAGCTCCCTGTCC | ||
| GCCTCTGTGGGCGATAGGGTCACCATCACCTGCCGTGCCAGTCAGGACATCCGTAATTATCTGAACTGG | ||
| TATCAACAGAAACCAGGAAAAGCTCCGAAACTACTGATTTACTATACCTCCCGCCTGGAGTCTGGAGTC | ||
| CCTTCTCGCTTCTCTGGTTCTGGTTCTGGGACGGATTACACTCTGACCATCAGCAGTCTGCAACCGGAA | ||
| GACTTCGCAACTTATTACTGTCAGCAAGGTAATACTCTGCCGTGGACGTTCGGACAGGGCACCAAGGTG | ||
| GAGATCAAAGGCGGCGGCGGAAGTGGAGGAGGAGGCTCAGGCGGAGGAGGGAGCGAGGTTCAGCTGGTG | ||
| GAGTCTGGCGGTGGCCTGGTGCAGCCAGGGGGCTCACTCCGTTTGTCCTGTGCAGCTTCTGGCTACTCC | ||
| TTTACCGGCTACACTATGAACTGGGTGCGTCAGGCCCCAGGTAAGGGCCTGGAATGGGTTGCACTGATT | ||
| AATCCTACCAAAGGTGTTAGTACCTACAACCAGAAGTTCAAGGACCGTTTCACTATAAGCGTAGATAAA | ||
| TCCAAAAACACAGCCTACCTGCAAATGAACAGCCTGCGTGCTGAGGACACTGCCGTCTATTATTGTGCT | ||
| AGAAGCGGATACTACGGCGATAGTGACTGGTATTTTGACGTGTGGGGTCAAGGAACCCTGGTCACCGTC | ||
| TCCTCGACATCTGGCGGCGGAGGATCTCTGGAATCTGGACAGGTGCTGCTGGAAAGCAACATCAAGGTG | ||
| CTGCCCACCTGGTCTACCCCAGTTCAGCCTATGGCTCTGATTGTGCTTGGCGGAGTTGCCGGCCTGCTG | ||
| CTCTTTATCGGCCTGGGCATCTTCTTTTGCGTGCGGTGCAGACATCGGCGGAGACAGGCTGAGAGAATG | ||
| AGCCAGATCAAGCGGCTGCTGAGCGAGAAGAAAACCTGTCAGTGCCCTCACCGGTTCCAGAAAACATGC | ||
| AGCCCCATC | ||
| 127 | Amino Acid | MALPVTALLLPLALLLHAARPQVQLVESGGGLVQPGGSLRLSCAASRNIASLYRVDWYRQAPGKGRELV |
| AGRTSGGTTTYLDAVEGRFTISRDNVKDTLYLQMNSLRAEDTAVYYCHAHDHWRDSWGQGTLVTVSSEQ | ||
| KLISEEDLNPGGGGGSGGGGSGGGGSGGGGSGSMDIQMTQSPSSLSASVGDRVTITCRASQDIRNYLNW | ||
| YQQKPGKAPKLLIYYTSRLESGVPSRESGSGSGTDYTLTISSLQPEDFATYYCQQGNTLPWTFGQGTKV | ||
| EIKGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCAASGYSFTGYTMNWVRQAPGKGLEWVALI | ||
| NPTKGVSTYNQKFKDRFTISVDKSKNTAYLQMNSLRAEDTAVYYCARSGYYGDSDWYFDVWGQGTLVTV | ||
| SSTSGGGGSLESGQVLLESNIKVLPTWSTPVQPMALIVLGGVAGLLLFIGLGIFFCVRCRHRRRQAERM | ||
| SQIKRLLSEKKTCQCPHRFQKTCSPI | ||
| 128 | Nucleotide | ATGGCTCTGCCTGTGACAGCTCTGTTGCTGCCTCTGGCTCTGCTGCTGCATGCTGCTAGACCTCAGGTG |
| CAGCTGGTTGAATCTGGCGGAGGATTGGTTCAGCCTGGCGGCTCTCTGAGACTGTCTTGTGCCGCCTCT | ||
| CGGAATATCGCCAGCCTGTACAGAGTGGACTGGGTCCGACAGGCTCCTGGCAAAGGACTGGAACTGGTG | ||
| GCTGGCAGAACCTCTGGCGGCACCACCACATATCTGGATGCCGTGGAAGGCCGGTTCACCATCTCCAGA | ||
| GACAACGTGAAGAACACCCTGTACCTGCAGATGAACTCTCTGACCCCTGAGGACACCGCCGTGTACTAC | ||
| TGTCACGCTCACGATCACTGGCGGGACTCTTGGGGACAGGGCACACAAGTGACAGTGTCCTCTGAGCAG | ||
| AAACTGATCAGCGAGGAAGATCTGAATCCTGGCGGCGGTGGAGGCAGCGGAGGTGGCGGGAGTGGCGGA | ||
| GGCGGTTCAGGGGGTGGAGGCTCTGGATCTATGGATATCCAGATGACCCAGTCCCCGAGCTCCCTGTCC | ||
| GCCTCTGTGGGCGATAGGGTCACCATCACCTGCCGTGCCAGTCAGGACATCCGTAATTATCTGAACTGG | ||
| TATCAACAGAAACCAGGAAAAGCTCCGAAACTACTGATTTACTATACCTCCCGCCTGGAGTCTGGAGTC | ||
| CCTTCTCGCTTCTCTGGTTCTGGTTCTGGGACGGATTACACTCTGACCATCAGCAGTCTGCAACCGGAA | ||
| GACTTCGCAACTTATTACTGTCAGCAAGGTAATACTCTGCCGTGGACGTTCGGACAGGGCACCAAGGTG | ||
| GAGATCAAAGGCGGCGGCGGAAGTGGAGGAGGAGGCTCAGGCGGAGGAGGGAGCGAGGTTCAGCTGGTG | ||
| GAGTCTGGCGGTGGCCTGGTGCAGCCAGGGGGCTCACTCCGTTTGTCCTGTGCAGCTTCTGGCTACTCC | ||
| TTTACCGGCTACACTATGAACTGGGTGCGTCAGGCCCCAGGTAAGGGCCTGGAATGGGTTGCACTGATT | ||
| AATCCTACCAAAGGTGTTAGTACCTACAACCAGAAGTTCAAGGACCGTTTCACTATAAGCGTAGATAAA | ||
| TCCAAAAACACAGCCTACCTGCAAATGAACAGCCTGCGTGCTGAGGACACTGCCGTCTATTATTGTGCT | ||
| AGAAGCGGATACTACGGCGATAGTGACTGGTATTTTGACGTGTGGGGTCAAGGAACCCTGGTCACCGTC | ||
| TCCTCGACATCTGGCGGCGGAGGATCTCTGGAATCTGGACAGGTGCTGCTGGAAAGCAACATCAAGGTG | ||
| CTGCCCACCTGGTCTACCCCAGTTCAGCCTATGGCTCTGATTGTGCTTGGCGGAGTTGCCGGCCTGCTG | ||
| CTCTTTATCGGCCTGGGCATCTTCTTTTGCGTGCGGTGCAGACATCGGCGGAGACAGGCTGAGAGAATG | ||
| AGCCAGATCAAGCGGCTGCTGAGCGAGAAGAAAACCTGTCAGTGCCCTCACCGGTTCCAGAAAACATGC | ||
| AGCCCCATC | ||
| 129 | Amino Acid | MALPVTALLLPLALLLHAARPQVQLVESGGGLVQPGGSLRLSCAASRNIASLYRVDWVRQAPGKGLELV |
| AGRTSGGTTTYLDAVEGRFTISRDNVKNTLYLQMNSLTPEDTAVYYCHAHDHWRDSWGQGTQVTVSSEQ | ||
| KLISEEDLNPGGGGGSGGGGSGGGGSGGGGSGSMDIQMTQSPSSLSASVGDRVTITCRASQDIRNYLNW | ||
| YQQKPGKAPKLLIYYTSRLESGVPSRESGSGSGTDYTLTISSLQPEDFATYYCQQGNTLPWTFGQGTKV | ||
| EIKGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCAASGYSFTGYTMNWVRQAPGKGLEWVALI | ||
| NPTKGVSTYNQKFKDRFTISVDKSKNTAYLQMNSLRAEDTAVYYCARSGYYGDSDWYFDVWGQGTLVTV | ||
| SSTSGGGGSLESGQVLLESNIKVLPTWSTPVQPMALIVLGGVAGLLLFIGLGIFFCVRCRHRRRQAERM | ||
| SQIKRLLSEKKTCQCPHRFQKTCSPI | ||
| 130 | Nucleotide | ATGGCTCTGCCTGTGACAGCTCTGTTGCTGCCTCTGGCTCTGCTGCTGCATGCTGCTAGACCTCAGGTG |
| CAGCTGGTTGAATCTGGCGGAGGATTGGTTCAGCCTGGCGGCTCTCTGAGACTGTCTTGTGCCGCCTCT | ||
| CGGAATATCGCCAGCCTGTACAGAGTGGACTGGTACAGACAGGCCCCTGGCAAAGGACTGGAACTGGTG | ||
| GCTGGAAGAACCTCTGGCGGCACCACCACCTATCTGGATGCTGTGGAAGGCCGGTTCACCATCTCTCGG | ||
| GACAACGTGAAGGACACCCTGTACCTGCAGATGAACTCCCTGAGAGCCGAGGACACCGCCGTGTACTAC | ||
| TGTCACGCTCACGATCACTGGCGGGACTCTTGGGGACAGGGAACACTGGTCACAGTGTCCTCTGAGCAG | ||
| AAACTGATCAGCGAGGAAGATCTGAATCCTGGCGGCGGTGGAGGCAGCGGAGGTGGCGGGAGTGGCGGA | ||
| GGCGGTTCAGGGGGTGGAGGCTCTGGATCTATGGATATCCAGATGACCCAGTCCCCGAGCTCCCTGTCC | ||
| GCCTCTGTGGGCGATAGGGTCACCATCACCTGCCGTGCCAGTCAGGACATCCGTAATTATCTGAACTGG | ||
| TATCAACAGAAACCAGGAAAAGCTCCGAAACTACTGATTTACTATACCTCCCGCCTGGAGTCTGGAGTC | ||
| CCTTCTCGCTTCTCTGGTTCTGGTTCTGGGACGGATTACACTCTGACCATCAGCAGTCTGCAACCGGAA | ||
| GACTTCGCAACTTATTACTGTCAGCAAGGTAATACTCTGCCGTGGACGTTCGGACAGGGCACCAAGGTG | ||
| GAGATCAAAGGCGGCGGCGGAAGTGGAGGAGGAGGCTCAGGCGGAGGAGGGAGCGAGGTTCAGCTGGTG | ||
| GAGTCTGGCGGTGGCCTGGTGCAGCCAGGGGGCTCACTCCGTTTGTCCTGTGCAGCTTCTGGCTACTCC | ||
| TTTACCGGCTACACTATGAACTGGGTGCGTCAGGCCCCAGGTAAGGGCCTGGAATGGGTTGCACTGATT | ||
| AATCCTACCAAAGGTGTTAGTACCTACAACCAGAAGTTCAAGGACCGTTTCACTATAAGCGTAGATAAA | ||
| TCCAAAAACACAGCCTACCTGCAAATGAACAGCCTGCGTGCTGAGGACACTGCCGTCTATTATTGTGCT | ||
| AGAAGCGGATACTACGGCGATAGTGACTGGTATTTTGACGTGTGGGGTCAAGGAACCCTGGTCACCGTC | ||
| TCCTCGACATCTGGCGGCGGAGGATCTCTGGAATCTGGACAGGTGCTGCTGGAAAGCAACATCAAGGTG | ||
| CTGCCCACCTGGTCTACCCCAGTTCAGCCTATGGCTCTGATTGTGCTTGGCGGAGTTGCCGGCCTGCTG | ||
| CTCTTTATCGGCCTGGGCATCTTCTTTTGCGTGCGGTGCAGACATCGGCGGAGACAGGCTGAGAGAATG | ||
| AGCCAGATCAAGCGGCTGCTGAGCGAGAAGAAAACCTGTCAGTGCCCTCACCGGTTCCAGAAAACATGC | ||
| AGCCCCATC | ||
| 131 | Amino Acid | MALPVTALLLPLALLLHAARPQVQLVESGGGLVQPGGSLRLSCAASRNIASLYRVDWYRQAPGKGLELV |
| AGRTSGGTTTYLDAVEGRFTISRDNVKDTLYLQMNSLRAEDTAVYYCHAHDHWRDSWGQGTLVTVSSEQ | ||
| KLISEEDLNPGGGGGSGGGGSGGGGSGGGGSGSMDIQMTQSPSSLSASVGDRVTITCRASQDIRNYLNW | ||
| YQQKPGKAPKLLIYYTSRLESGVPSRFSGSGSGTDYTLTISSLQPEDFATYYCQQGNTLPWTFGQGTKV | ||
| EIKGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCAASGYSFTGYTMNWVRQAPGKGLEWVALI | ||
| NPTKGVSTYNQKFKDRFTISVDKSKNTAYLQMNSLRAEDTAVYYCARSGYYGDSDWYFDVWGQGTLVTV | ||
| SSTSGGGGSLESGQVLLESNIKVLPTWSTPVQPMALIVLGGVAGLLLFIGLGIFFCVRCRHRRRQAERM | ||
| SQIKRLLSEKKTCQCPHRFQKTCSPI | ||
| 132 | Nucleotide | ATGGCTCTGCCTGTGACAGCTCTGTTGCTGCCTCTGGCTCTGCTGCTGCATGCTGCTAGACCTCAGGTG |
| CAGCTGGTTGAATCTGGCGGAGGATTGGTTCAGCCTGGCGGCTCTCTGAGACTGTCTTGTGCCGCCTCT | ||
| CGGAATATCGCCAGCCTGTACAGAGTGGACTGGTACAGACAGGCCCCTGGCAAAGGACTGGAACTGGTG | ||
| GCTGGAAGAACCTCTGGCGGCACCACCACCTATCTGGATGCTGTGGAAGGCCGGTTCACCATCTCTCGG | ||
| GACAACGTGAAGAACACCCTGTACCTGCAGATGAACTCCCTGAGAGCCGAGGACACCGCCGTGTACTAC | ||
| TGTCACGCTCACGATCACTGGCGGGACTCTTGGGGACAGGGAACACTGGTCACAGTGTCCTCTGAGCAG | ||
| AAACTGATCAGCGAGGAAGATCTGAATCCTGGCGGCGGTGGAGGCAGCGGAGGTGGCGGGAGTGGCGGA | ||
| GGCGGTTCAGGGGGTGGAGGCTCTGGATCTATGGATATCCAGATGACCCAGTCCCCGAGCTCCCTGTCC | ||
| GCCTCTGTGGGCGATAGGGTCACCATCACCTGCCGTGCCAGTCAGGACATCCGTAATTATCTGAACTGG | ||
| TATCAACAGAAACCAGGAAAAGCTCCGAAACTACTGATTTACTATACCTCCCGCCTGGAGTCTGGAGTC | ||
| CCTTCTCGCTTCTCTGGTTCTGGTTCTGGGACGGATTACACTCTGACCATCAGCAGTCTGCAACCGGAA | ||
| GACTTCGCAACTTATTACTGTCAGCAAGGTAATACTCTGCCGTGGACGTTCGGACAGGGCACCAAGGTG | ||
| GAGATCAAAGGCGGCGGCGGAAGTGGAGGAGGAGGCTCAGGCGGAGGAGGGAGCGAGGTTCAGCTGGTG | ||
| GAGTCTGGCGGTGGCCTGGTGCAGCCAGGGGGCTCACTCCGTTTGTCCTGTGCAGCTTCTGGCTACTCC | ||
| TTTACCGGCTACACTATGAACTGGGTGCGTCAGGCCCCAGGTAAGGGCCTGGAATGGGTTGCACTGATT | ||
| AATCCTACCAAAGGTGTTAGTACCTACAACCAGAAGTTCAAGGACCGTTTCACTATAAGCGTAGATAAA | ||
| TCCAAAAACACAGCCTACCTGCAAATGAACAGCCTGCGTGCTGAGGACACTGCCGTCTATTATTGTGCT | ||
| AGAAGCGGATACTACGGCGATAGTGACTGGTATTTTGACGTGTGGGGTCAAGGAACCCTGGTCACCGTC | ||
| TCCTCGACATCTGGCGGCGGAGGATCTCTGGAATCTGGACAGGTGCTGCTGGAAAGCAACATCAAGGTG | ||
| CTGCCCACCTGGTCTACCCCAGTTCAGCCTATGGCTCTGATTGTGCTTGGCGGAGTTGCCGGCCTGCTG | ||
| CTCTTTATCGGCCTGGGCATCTTCTTTTGCGTGCGGTGCAGACATCGGCGGAGACAGGCTGAGAGAATG | ||
| AGCCAGATCAAGCGGCTGCTGAGCGAGAAGAAAACCTGTCAGTGCCCTCACCGGTTCCAGAAAACATGC | ||
| AGCCCCATC | ||
| 133 | Amino Acid | MALPVTALLLPLALLLHAARPQVQLVESGGGLVQPGGSLRLSCAASRNIASLYRVDWYRQAPGKGLELV |
| AGRTSGGTTTYLDAVEGRFTISRDNVKNTLYLQMNSLRAEDTAVYYCHAHDHWRDSWGQGTLVTVSSEQ | ||
| KLISEEDLNPGGGGGSGGGGSGGGGSGGGGSGSMDIQMTQSPSSLSASVGDRVTITCRASQDIRNYLNW | ||
| YQQKPGKAPKLLIYYTSRLESGVPSRESGSGSGTDYTLTISSLQPEDFATYYCQQGNTLPWTFGQGTKV | ||
| EIKGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCAASGYSFTGYTMNWVRQAPGKGLEWVALI | ||
| NPTKGVSTYNQKFKDRFTISVDKSKNTAYLQMNSLRAEDTAVYYCARSGYYGDSDWYFDVWGQGTLVTV | ||
| SSTSGGGGSLESGQVLLESNIKVLPTWSTPVQPMALIVLGGVAGLLLFIGLGIFFCVRCRHRRRQAERM | ||
| SQIKRLLSEKKTCQCPHRFQKTCSPI | ||
| 134 | Nucleotide | ATGGCTCTGCCTGTGACAGCTCTGTTGCTGCCTCTGGCTCTGCTGCTGCATGCTGCTAGACCTCAGGTG |
| CAGCTGGTTGAATCTGGCGGAGGATTGGTTCAGCCTGGCGGCTCTCTGAGACTGTCTTGTGCCGCCTCT | ||
| CGGAATATCGCCAGCCTGTACAGAGTGGACTGGGTCCGACAGGCTCCTGGCAAAGGACTGGAACTGGTG | ||
| GCTGGCAGAACCTCTGGCGGCACCACCACATATCTGGATGCCGTGGAAGGCCGGTTCACCATCTCCAGA | ||
| GACAACGTGAAGAACACCCTGTACCTGCAGATGAACTCCCTGAGAGCCGAGGACACCGCCGTGTACTAC | ||
| TGTCACGCTCACGATCACTGGCGGGACTCTTGGGGACAGGGAACACTGGTCACAGTGTCCTCTGAGCAG | ||
| AAACTGATCAGCGAGGAAGATCTGAATCCTGGCGGCGGTGGAGGCAGCGGAGGTGGCGGGAGTGGCGGA | ||
| GGCGGTTCAGGGGGTGGAGGCTCTGGATCTATGGATATCCAGATGACCCAGTCCCCGAGCTCCCTGTCC | ||
| GCCTCTGTGGGCGATAGGGTCACCATCACCTGCCGTGCCAGTCAGGACATCCGTAATTATCTGAACTGG | ||
| TATCAACAGAAACCAGGAAAAGCTCCGAAACTACTGATTTACTATACCTCCCGCCTGGAGTCTGGAGTC | ||
| CCTTCTCGCTTCTCTGGTTCTGGTTCTGGGACGGATTACACTCTGACCATCAGCAGTCTGCAACCGGAA | ||
| GACTTCGCAACTTATTACTGTCAGCAAGGTAATACTCTGCCGTGGACGTTCGGACAGGGCACCAAGGTG | ||
| GAGATCAAAGGCGGCGGCGGAAGTGGAGGAGGAGGCTCAGGCGGAGGAGGGAGCGAGGTTCAGCTGGTG | ||
| GAGTCTGGCGGTGGCCTGGTGCAGCCAGGGGGCTCACTCCGTTTGTCCTGTGCAGCTTCTGGCTACTCC | ||
| TTTACCGGCTACACTATGAACTGGGTGCGTCAGGCCCCAGGTAAGGGCCTGGAATGGGTTGCACTGATT | ||
| AATCCTACCAAAGGTGTTAGTACCTACAACCAGAAGTTCAAGGACCGTTTCACTATAAGCGTAGATAAA | ||
| TCCAAAAACACAGCCTACCTGCAAATGAACAGCCTGCGTGCTGAGGACACTGCCGTCTATTATTGTGCT | ||
| AGAAGCGGATACTACGGCGATAGTGACTGGTATTTTGACGTGTGGGGTCAAGGAACCCTGGTCACCGTC | ||
| TCCTCGACATCTGGCGGCGGAGGATCTCTGGAATCTGGACAGGTGCTGCTGGAAAGCAACATCAAGGTG | ||
| CTGCCCACCTGGTCTACCCCAGTTCAGCCTATGGCTCTGATTGTGCTTGGCGGAGTTGCCGGCCTGCTG | ||
| CTCTTTATCGGCCTGGGCATCTTCTTTTGCGTGCGGTGCAGACATCGGCGGAGACAGGCTGAGAGAATG | ||
| AGCCAGATCAAGCGGCTGCTGAGCGAGAAGAAAACCTGTCAGTGCCCTCACCGGTTCCAGAAAACATGC | ||
| AGCCCCATC | ||
| 135 | Amino Acid | MALPVTALLLPLALLLHAARPQVQLVESGGGLVQPGGSLRLSCAASRNIASLYRVDWVRQAPGKGLELV |
| AGRTSGGTTTYLDAVEGRFTISRDNVKNTLYLQMNSLRAEDTAVYYCHAHDHWRDSWGQGTLVTVSSEQ | ||
| KLISEEDLNPGGGGGSGGGGSGGGGSGGGGSGSMDIQMTQSPSSLSASVGDRVTITCRASQDIRNYLNW | ||
| YQQKPGKAPKLLIYYTSRLESGVPSRFSGSGSGTDYTLTISSLQPEDFATYYCQQGNTLPWTFGQGTKV | ||
| EIKGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCAASGYSFTGYTMNWVRQAPGKGLEWVALI | ||
| NPTKGVSTYNQKFKDRFTISVDKSKNTAYLQMNSLRAEDTAVYYCARSGYYGDSDWYFDVWGQGTLVTV | ||
| SSTSGGGGSLESGQVLLESNIKVLPTWSTPVQPMALIVLGGVAGLLLFIGLGIFFCVRCRHRRRQAERM | ||
| SQIKRLLSEKKTCQCPHRFQKTCSPI | ||
| 136 | Nucleotide | ATGGCTCTGCCTGTGACAGCTCTGTTGCTGCCTCTGGCTCTGCTGCTGCATGCTGCTAGACCTGAGGTG |
| CAGCTGGTTGAATCTGGCGGAGGATTGGTTCAGCCTGGCGGCTCTCTGAGACTGTCTTGTGCCGCCTCT | ||
| CGGAACATCTTCAGCCTGTACAGAGTGGACTGGTACAGACAGGCCCCTGGCAAGCAGAGAGAACTGGTC | ||
| GCTGGATCTACCTCTGGCGGCACCACCACCTATGCCGATGCTGTGAAGGGCAGATTCACCATCTCCACC | ||
| GACAACGTGAAGGACACCGTGTACCTGCAGATGAACTCCCTGAGAGCCGAGGACACCGCCGTGTACTAC | ||
| TGTCACGCTCACGATCACTGGCGGGACTCTTGGGGACAGGGAACACTGGTCACAGTGTCCTCTGAGCAG | ||
| AAACTGATCAGCGAGGAAGATCTGAATCCTGGCGGCGGTGGAGGCAGCGGAGGTGGCGGGAGTGGCGGA | ||
| GGCGGTTCAGGGGGTGGAGGCTCTGGATCTATGGATATCCAGATGACCCAGTCCCCGAGCTCCCTGTCC | ||
| GCCTCTGTGGGCGATAGGGTCACCATCACCTGCCGTGCCAGTCAGGACATCCGTAATTATCTGAACTGG | ||
| TATCAACAGAAACCAGGAAAAGCTCCGAAACTACTGATTTACTATACCTCCCGCCTGGAGTCTGGAGTC | ||
| CCTTCTCGCTTCTCTGGTTCTGGTTCTGGGACGGATTACACTCTGACCATCAGCAGTCTGCAACCGGAA | ||
| GACTTCGCAACTTATTACTGTCAGCAAGGTAATACTCTGCCGTGGACGTTCGGACAGGGCACCAAGGTG | ||
| GAGATCAAAGGCGGCGGCGGAAGTGGAGGAGGAGGCTCAGGCGGAGGAGGGAGCGAGGTTCAGCTGGTG | ||
| GAGTCTGGCGGTGGCCTGGTGCAGCCAGGGGGCTCACTCCGTTTGTCCTGTGCAGCTTCTGGCTACTCC | ||
| TTTACCGGCTACACTATGAACTGGGTGCGTCAGGCCCCAGGTAAGGGCCTGGAATGGGTTGCACTGATT | ||
| AATCCTACCAAAGGTGTTAGTACCTACAACCAGAAGTTCAAGGACCGTTTCACTATAAGCGTAGATAAA | ||
| TCCAAAAACACAGCCTACCTGCAAATGAACAGCCTGCGTGCTGAGGACACTGCCGTCTATTATTGTGCT | ||
| AGAAGCGGATACTACGGCGATAGTGACTGGTATTTTGACGTGTGGGGTCAAGGAACCCTGGTCACCGTC | ||
| TCCTCGACATCTGGCGGCGGAGGATCTCTGGAATCTGGACAGGTGCTGCTGGAAAGCAACATCAAGGTG | ||
| CTGCCCACCTGGTCTACCCCAGTTCAGCCTATGGCTCTGATTGTGCTTGGCGGAGTTGCCGGCCTGCTG | ||
| CTCTTTATCGGCCTGGGCATCTTCTTTTGCGTGCGGTGCAGACATCGGCGGAGACAGGCTGAGAGAATG | ||
| AGCCAGATCAAGCGGCTGCTGAGCGAGAAGAAAACCTGTCAGTGCCCTCACCGGTTCCAGAAAACATGC | ||
| AGCCCCATC | ||
| 137 | Amino Acid | MALPVTALLLPLALLLHAARPEVQLVESGGGLVQPGGSLRLSCAASRNIFSLYRVDWYRQAPGKQRELV |
| AGSTSGGTTTYADAVKGRFTISTDNVKDTVYLQMNSLRAEDTAVYYCHAHDHWRDSWGQGTLVTVSSEQ | ||
| KLISEEDLNPGGGGGSGGGGSGGGGSGGGGSGSMDIQMTQSPSSLSASVGDRVTITCRASQDIRNYLNW | ||
| YQQKPGKAPKLLIYYTSRLESGVPSRESGSGSGTDYTLTISSLQPEDFATYYCQQGNTLPWTFGQGTKV | ||
| EIKGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCAASGYSFTGYTMNWVRQAPGKGLEWVALI | ||
| NPTKGVSTYNQKEKDRFTISVDKSKNTAYLQMNSLRAEDTAVYYCARSGYYGDSDWYFDVWGQGTLVTV | ||
| SSTSGGGGSLESGQVLLESNIKVLPTWSTPVQPMALIVLGGVAGLLLFIGLGIFFCVRCRHRRRQAERM | ||
| SQIKRLLSEKKTCQCPHRFQKTCSPI | ||
| 138 | Nucleotide | ATGGCTCTGCCTGTGACAGCTCTGTTGCTGCCTCTGGCTCTGCTGCTGCATGCTGCTAGACCTGAGGTG |
| CAGCTGGTTGAATCTGGCGGAGGATTGGTTCAGCCTGGCGGCTCTCTGAGACTGTCTTGTGCCGCCTCT | ||
| CGGAACATCTTCAGCCTGTACAGAGTGGACTGGGTCCGACAGGCTCCTGGCAAAGGACTGGAACTGGTG | ||
| GCTGGCTCTACCTCTGGCGGCACCACAACCTATGCCGATGCTGTGAAGGGCAGATTCACCATCTCCACC | ||
| GACAACGTGAAGGACACCGTGTACCTGCAGATGAACTCTCTGACCCCTGAGGACACCGCCGTGTACTAC | ||
| TGTCACGCTCACGATCACTGGCGGGACTCTTGGGGACAGGGAACACTGGTCACAGTGTCCTCTGAGCAG | ||
| AAACTGATCAGCGAGGAAGATCTGAATCCTGGCGGCGGTGGAGGCAGCGGAGGTGGCGGGAGTGGCGGA | ||
| GGCGGTTCAGGGGGTGGAGGCTCTGGATCTATGGATATCCAGATGACCCAGTCCCCGAGCTCCCTGTCC | ||
| GCCTCTGTGGGCGATAGGGTCACCATCACCTGCCGTGCCAGTCAGGACATCCGTAATTATCTGAACTGG | ||
| TATCAACAGAAACCAGGAAAAGCTCCGAAACTACTGATTTACTATACCTCCCGCCTGGAGTCTGGAGTC | ||
| CCTTCTCGCTTCTCTGGTTCTGGTTCTGGGACGGATTACACTCTGACCATCAGCAGTCTGCAACCGGAA | ||
| GACTTCGCAACTTATTACTGTCAGCAAGGTAATACTCTGCCGTGGACGTTCGGACAGGGCACCAAGGTG | ||
| GAGATCAAAGGCGGCGGCGGAAGTGGAGGAGGAGGCTCAGGCGGAGGAGGGAGCGAGGTTCAGCTGGTG | ||
| GAGTCTGGCGGTGGCCTGGTGCAGCCAGGGGGCTCACTCCGTTTGTCCTGTGCAGCTTCTGGCTACTCC | ||
| TTTACCGGCTACACTATGAACTGGGTGCGTCAGGCCCCAGGTAAGGGCCTGGAATGGGTTGCACTGATT | ||
| AATCCTACCAAAGGTGTTAGTACCTACAACCAGAAGTTCAAGGACCGTTTCACTATAAGCGTAGATAAA | ||
| TCCAAAAACACAGCCTACCTGCAAATGAACAGCCTGCGTGCTGAGGACACTGCCGTCTATTATTGTGCT | ||
| AGAAGCGGATACTACGGCGATAGTGACTGGTATTTTGACGTGTGGGGTCAAGGAACCCTGGTCACCGTC | ||
| TCCTCGACATCTGGCGGCGGAGGATCTCTGGAATCTGGACAGGTGCTGCTGGAAAGCAACATCAAGGTG | ||
| CTGCCCACCTGGTCTACCCCAGTTCAGCCTATGGCTCTGATTGTGCTTGGCGGAGTTGCCGGCCTGCTG | ||
| CTCTTTATCGGCCTGGGCATCTTCTTTTGCGTGCGGTGCAGACATCGGCGGAGACAGGCTGAGAGAATG | ||
| AGCCAGATCAAGCGGCTGCTGAGCGAGAAGAAAACCTGTCAGTGCCCTCACCGGTTCCAGAAAACATGC | ||
| AGCCCCATC | ||
| 139 | Amino Acid | MALPVTALLLPLALLLHAARPEVQLVESGGGLVQPGGSLRLSCAASRNIFSLYRVDWVRQAPGKGLELV |
| AGSTSGGTTTYADAVKGRFTISTDNVKDTVYLQMNSLTPEDTAVYYCHAHDHWRDSWGQGTLVTVSSEQ | ||
| KLISEEDLNPGGGGGSGGGGSGGGGSGGGGSGSMDIQMTQSPSSLSASVGDRVTITCRASQDIRNYLNW | ||
| YQQKPGKAPKLLIYYTSRLESGVPSRESGSGSGTDYTLTISSLQPEDFATYYCQQGNTLPWTFGQGTKV | ||
| EIKGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCAASGYSFTGYTMNWVRQAPGKGLEWVALI | ||
| NPTKGVSTYNQKFKDRFTISVDKSKNTAYLQMNSLRAEDTAVYYCARSGYYGDSDWYFDVWGQGTLVTV | ||
| SSTSGGGGSLESGQVLLESNIKVLPTWSTPVQPMALIVLGGVAGLLLFIGLGIFFCVRCRHRRRQAERM | ||
| SQIKRLLSEKKTCQCPHRFQKTCSPI | ||
| 140 | Nucleotide | ATGGCTCTGCCTGTGACAGCTCTGTTGCTGCCTCTGGCTCTGCTGCTGCATGCTGCTAGACCTGAGGTG |
| CAGCTGGTTGAATCTGGCGGAGGATTGGTTCAGCCTGGCGGCTCTCTGAGACTGTCTTGTGCCGCCTCT | ||
| CGGAACATCTTCAGCCTGTACAGAGTGGACTGGTACAGACAGGCCCCTGGCAAGCAGAGAGAACTGGTC | ||
| GCTGGATCTACCTCTGGCGGCACCACCACCTATGCCGATGCTGTGAAGGGCAGATTCACCATCAGCCGG | ||
| GACAACGTGAAGAACACCCTGTACCTGCAGATGAACTCCCTGAGAGCCGAGGACACCGCCGTGTACTAC | ||
| TGTCACGCTCACGATCACTGGCGGGACTCTTGGGGACAGGGCACACAAGTGACAGTGTCCTCTGAGCAG | ||
| AAACTGATCAGCGAGGAAGATCTGAATCCTGGCGGCGGTGGAGGCAGCGGAGGTGGCGGGAGTGGCGGA | ||
| GGCGGTTCAGGGGGTGGAGGCTCTGGATCTATGGATATCCAGATGACCCAGTCCCCGAGCTCCCTGTCC | ||
| GCCTCTGTGGGCGATAGGGTCACCATCACCTGCCGTGCCAGTCAGGACATCCGTAATTATCTGAACTGG | ||
| TATCAACAGAAACCAGGAAAAGCTCCGAAACTACTGATTTACTATACCTCCCGCCTGGAGTCTGGAGTC | ||
| CCTTCTCGCTTCTCTGGTTCTGGTTCTGGGACGGATTACACTCTGACCATCAGCAGTCTGCAACCGGAA | ||
| GACTTCGCAACTTATTACTGTCAGCAAGGTAATACTCTGCCGTGGACGTTCGGACAGGGCACCAAGGTG | ||
| GAGATCAAAGGCGGCGGCGGAAGTGGAGGAGGAGGCTCAGGCGGAGGAGGGAGCGAGGTTCAGCTGGTG | ||
| GAGTCTGGCGGTGGCCTGGTGCAGCCAGGGGGCTCACTCCGTTTGTCCTGTGCAGCTTCTGGCTACTCC | ||
| TTTACCGGCTACACTATGAACTGGGTGCGTCAGGCCCCAGGTAAGGGCCTGGAATGGGTTGCACTGATT | ||
| AATCCTACCAAAGGTGTTAGTACCTACAACCAGAAGTTCAAGGACCGTTTCACTATAAGCGTAGATAAA | ||
| TCCAAAAACACAGCCTACCTGCAAATGAACAGCCTGCGTGCTGAGGACACTGCCGTCTATTATTGTGCT | ||
| AGAAGCGGATACTACGGCGATAGTGACTGGTATTTTGACGTGTGGGGTCAAGGAACCCTGGTCACCGTC | ||
| TCCTCGACATCTGGCGGCGGAGGATCTCTGGAATCTGGACAGGTGCTGCTGGAAAGCAACATCAAGGTG | ||
| CTGCCCACCTGGTCTACCCCAGTTCAGCCTATGGCTCTGATTGTGCTTGGCGGAGTTGCCGGCCTGCTG | ||
| CTCTTTATCGGCCTGGGCATCTTCTTTTGCGTGCGGTGCAGACATCGGCGGAGACAGGCTGAGAGAATG | ||
| AGCCAGATCAAGCGGCTGCTGAGCGAGAAGAAAACCTGTCAGTGCCCTCACCGGTTCCAGAAAACATGC | ||
| AGCCCCATC | ||
| 141 | Amino Acid | MALPVTALLLPLALLLHAARPEVQLVESGGGLVQPGGSLRLSCAASRNIFSLYRVDWYRQAPGKQRELV |
| AGSTSGGTTTYADAVKGRFTISRDNVKNTLYLQMNSLRAEDTAVYYCHAHDHWRDSWGQGTQVTVSSEQ | ||
| KLISEEDLNPGGGGGSGGGGSGGGGSGGGGSGSMDIQMTQSPSSLSASVGDRVTITCRASQDIRNYLNW | ||
| YQQKPGKAPKLLIYYTSRLESGVPSRFSGSGSGTDYTLTISSLQPEDFATYYCQQGNTLPWTFGQGTKV | ||
| EIKGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCAASGYSFTGYTMNWVRQAPGKGLEWVALI | ||
| NPTKGVSTYNQKFKDRFTISVDKSKNTAYLQMNSLRAEDTAVYYCARSGYYGDSDWYFDVWGQGTLVTV | ||
| SSTSGGGGSLESGQVLLESNIKVLPTWSTPVQPMALIVLGGVAGLLLFIGLGIFFCVRCRHRRRQAERM | ||
| SQIKRLLSEKKTCQCPHRFQKTCSPI | ||
| 142 | Nucleotide | ATGGCTCTGCCTGTGACAGCTCTGTTGCTGCCTCTGGCTCTGCTGCTGCATGCTGCTAGACCTGAGGTG |
| CAGCTGGTTGAATCTGGCGGAGGATTGGTTCAGCCTGGCGGCTCTCTGAGACTGTCTTGTGCCGCCTCT | ||
| CGGAACATCTTCAGCCTGTACAGAGTGGACTGGTACAGACAGGCCCCTGGCAAAGGACTGGAACTGGTG | ||
| GCTGGATCTACCTCTGGCGGCACCACCACCTATGCCGATGCTGTGAAGGGCAGATTCACCATCTCCACC | ||
| GACAACGTGAAGAACACCCTGTACCTGCAGATGAACTCTCTGACCCCTGAGGACACCGCCGTGTACTAC | ||
| TGTCACGCTCACGATCACTGGCGGGACTCTTGGGGACAGGGAACACTGGTCACAGTGTCCTCTGAGCAG | ||
| AAACTGATCAGCGAGGAAGATCTGAATCCTGGCGGCGGTGGAGGCAGCGGAGGTGGCGGGAGTGGCGGA | ||
| GGCGGTTCAGGGGGTGGAGGCTCTGGATCTATGGATATCCAGATGACCCAGTCCCCGAGCTCCCTGTCC | ||
| GCCTCTGTGGGCGATAGGGTCACCATCACCTGCCGTGCCAGTCAGGACATCCGTAATTATCTGAACTGG | ||
| TATCAACAGAAACCAGGAAAAGCTCCGAAACTACTGATTTACTATACCTCCCGCCTGGAGTCTGGAGTC | ||
| CCTTCTCGCTTCTCTGGTTCTGGTTCTGGGACGGATTACACTCTGACCATCAGCAGTCTGCAACCGGAA | ||
| GACTTCGCAACTTATTACTGTCAGCAAGGTAATACTCTGCCGTGGACGTTCGGACAGGGCACCAAGGTG | ||
| GAGATCAAAGGCGGCGGCGGAAGTGGAGGAGGAGGCTCAGGCGGAGGAGGGAGCGAGGTTCAGCTGGTG | ||
| GAGTCTGGCGGTGGCCTGGTGCAGCCAGGGGGCTCACTCCGTTTGTCCTGTGCAGCTTCTGGCTACTCC | ||
| TTTACCGGCTACACTATGAACTGGGTGCGTCAGGCCCCAGGTAAGGGCCTGGAATGGGTTGCACTGATT | ||
| AATCCTACCAAAGGTGTTAGTACCTACAACCAGAAGTTCAAGGACCGTTTCACTATAAGCGTAGATAAA | ||
| TCCAAAAACACAGCCTACCTGCAAATGAACAGCCTGCGTGCTGAGGACACTGCCGTCTATTATTGTGCT | ||
| AGAAGCGGATACTACGGCGATAGTGACTGGTATTTTGACGTGTGGGGTCAAGGAACCCTGGTCACCGTC | ||
| TCCTCGACATCTGGCGGCGGAGGATCTCTGGAATCTGGACAGGTGCTGCTGGAAAGCAACATCAAGGTG | ||
| CTGCCCACCTGGTCTACCCCAGTTCAGCCTATGGCTCTGATTGTGCTTGGCGGAGTTGCCGGCCTGCTG | ||
| CTCTTTATCGGCCTGGGCATCTTCTTTTGCGTGCGGTGCAGACATCGGCGGAGACAGGCTGAGAGAATG | ||
| AGCCAGATCAAGCGGCTGCTGAGCGAGAAGAAAACCTGTCAGTGCCCTCACCGGTTCCAGAAAACATGC | ||
| AGCCCCATC | ||
| 143 | Amino Acid | MALPVTALLLPLALLLHAARPEVQLVESGGGLVQPGGSLRLSCAASRNIFSLYRVDWYRQAPGKGLELV |
| AGSTSGGTTTYADAVKGRFTISTDNVKNTLYLQMNSLTPEDTAVYYCHAHDHWRDSWGQGTLVTVSSEQ | ||
| KLISEEDLNPGGGGGSGGGGSGGGGSGGGGSGSMDIQMTQSPSSLSASVGDRVTITCRASQDIRNYLNW | ||
| YQQKPGKAPKLLIYYTSRLESGVPSRFSGSGSGTDYTLTISSLQPEDFATYYCQQGNTLPWTFGQGTKV | ||
| EIKGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCAASGYSFTGYTMNWVRQAPGKGLEWVALI | ||
| NPTKGVSTYNQKFKDRFTISVDKSKNTAYLQMNSLRAEDTAVYYCARSGYYGDSDWYFDVWGQGTLVTV | ||
| SSTSGGGGSLESGQVLLESNIKVLPTWSTPVQPMALIVLGGVAGLLLFIGLGIFFCVRCRHRRRQAERM | ||
| SQIKRLLSEKKTCQCPHRFQKTCSPI | ||
| 144 | Nucleotide | ATGGCTCTGCCTGTGACAGCTCTGTTGCTGCCTCTGGCTCTGCTGCTGCATGCTGCTAGACCTGAGGTG |
| CAGCTGGTTGAATCTGGCGGAGGATTGGTTCAGCCTGGCGGCTCTCTGAGACTGTCTTGTGCCGCCTCT | ||
| CGGAACATCTTCAGCCTGTACAGAGTGGACTGGGTCCGACAGGCTCCTGGCAAGGGAAGAGAACTGGTG | ||
| GCTGGCTCTACCTCTGGCGGCACCACAACCTATGCCGATGCTGTGAAGGGCAGATTCACCATCAGCCGG | ||
| GACAACGTGAAGGACACCGTGTACCTGCAGATGAACTCCCTGAGAGCCGAGGACACCGCCGTGTACTAC | ||
| TGTCACGCTCACGATCACTGGCGGGACTCTTGGGGACAGGGAACACTGGTCACAGTGTCCTCTGAGCAG | ||
| AAACTGATCAGCGAGGAAGATCTGAATCCTGGCGGCGGTGGAGGCAGCGGAGGTGGCGGGAGTGGCGGA | ||
| GGCGGTTCAGGGGGTGGAGGCTCTGGATCTATGGATATCCAGATGACCCAGTCCCCGAGCTCCCTGTCC | ||
| GCCTCTGTGGGCGATAGGGTCACCATCACCTGCCGTGCCAGTCAGGACATCCGTAATTATCTGAACTGG | ||
| TATCAACAGAAACCAGGAAAAGCTCCGAAACTACTGATTTACTATACCTCCCGCCTGGAGTCTGGAGTC | ||
| CCTTCTCGCTTCTCTGGTTCTGGTTCTGGGACGGATTACACTCTGACCATCAGCAGTCTGCAACCGGAA | ||
| GACTTCGCAACTTATTACTGTCAGCAAGGTAATACTCTGCCGTGGACGTTCGGACAGGGCACCAAGGTG | ||
| GAGATCAAAGGCGGCGGCGGAAGTGGAGGAGGAGGCTCAGGCGGAGGAGGGAGCGAGGTTCAGCTGGTG | ||
| GAGTCTGGCGGTGGCCTGGTGCAGCCAGGGGGCTCACTCCGTTTGTCCTGTGCAGCTTCTGGCTACTCC | ||
| TTTACCGGCTACACTATGAACTGGGTGCGTCAGGCCCCAGGTAAGGGCCTGGAATGGGTTGCACTGATT | ||
| AATCCTACCAAAGGTGTTAGTACCTACAACCAGAAGTTCAAGGACCGTTTCACTATAAGCGTAGATAAA | ||
| TCCAAAAACACAGCCTACCTGCAAATGAACAGCCTGCGTGCTGAGGACACTGCCGTCTATTATTGTGCT | ||
| AGAAGCGGATACTACGGCGATAGTGACTGGTATTTTGACGTGTGGGGTCAAGGAACCCTGGTCACCGTC | ||
| TCCTCGACATCTGGCGGCGGAGGATCTCTGGAATCTGGACAGGTGCTGCTGGAAAGCAACATCAAGGTG | ||
| CTGCCCACCTGGTCTACCCCAGTTCAGCCTATGGCTCTGATTGTGCTTGGCGGAGTTGCCGGCCTGCTG | ||
| CTCTTTATCGGCCTGGGCATCTTCTTTTGCGTGCGGTGCAGACATCGGCGGAGACAGGCTGAGAGAATG | ||
| AGCCAGATCAAGCGGCTGCTGAGCGAGAAGAAAACCTGTCAGTGCCCTCACCGGTTCCAGAAAACATGC | ||
| AGCCCCATC | ||
| 145 | Amino Acid | MALPVTALLLPLALLLHAARPEVQLVESGGGLVQPGGSLRLSCAASRNIFSLYRVDWVRQAPGKGRELV |
| AGSTSGGTTTYADAVKGRFTISRDNVKDTVYLQMNSLRAEDTAVYYCHAHDHWRDSWGQGTLVTVSSEQ | ||
| KLISEEDLNPGGGGGSGGGGSGGGGSGGGGSGSMDIQMTQSPSSLSASVGDRVTITCRASQDIRNYLNW | ||
| YQQKPGKAPKLLIYYTSRLESGVPSRFSGSGSGTDYTLTISSLQPEDFATYYCQQGNTLPWTFGQGTKV | ||
| EIKGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCAASGYSFTGYTMNWVRQAPGKGLEWVALI | ||
| NPTKGVSTYNQKFKDRFTISVDKSKNTAYLQMNSLRAEDTAVYYCARSGYYGDSDWYFDVWGQGTLVTV | ||
| SSTSGGGGSLESGQVLLESNIKVLPTWSTPVQPMALIVLGGVAGLLLFIGLGIFFCVRCRHRRRQAERM | ||
| SQIKRLLSEKKTCQCPHRFQKTCSPI | ||
| 146 | Nucleotide | ATGGCTCTGCCTGTGACAGCTCTGTTGCTGCCTCTGGCTCTGCTGCTGCATGCTGCTAGACCTGAGGTG |
| CAGCTGGTTGAATCTGGCGGAGGATTGGTTCAGCCTGGCGGCTCTCTGAGACTGTCTTGTGCCGCCTCT | ||
| CGGAACATCTTCAGCCTGTACAGAGTGGACTGGTACAGACAGGCCCCTGGCAAAGGACTGGAACTGGTG | ||
| GCTGGATCTACCTCTGGCGGCACCACCACCTATGCCGATGCTGTGAAGGGCAGATTCACCATCTCCACC | ||
| GACAACGTGAAGGACACCCTGTACCTGCAGATGAACTCCCTGAGAGCCGAGGACACCGCCGTGTACTAC | ||
| TGTCACGCTCACGATCACTGGCGGGACTCTTGGGGACAGGGAACACTGGTCACAGTGTCCTCTGAGCAG | ||
| AAACTGATCAGCGAGGAAGATCTGAATCCTGGCGGCGGTGGAGGCAGCGGAGGTGGCGGGAGTGGCGGA | ||
| GGCGGTTCAGGGGGTGGAGGCTCTGGATCTATGGATATCCAGATGACCCAGTCCCCGAGCTCCCTGTCC | ||
| GCCTCTGTGGGCGATAGGGTCACCATCACCTGCCGTGCCAGTCAGGACATCCGTAATTATCTGAACTGG | ||
| TATCAACAGAAACCAGGAAAAGCTCCGAAACTACTGATTTACTATACCTCCCGCCTGGAGTCTGGAGTC | ||
| CCTTCTCGCTTCTCTGGTTCTGGTTCTGGGACGGATTACACTCTGACCATCAGCAGTCTGCAACCGGAA | ||
| GACTTCGCAACTTATTACTGTCAGCAAGGTAATACTCTGCCGTGGACGTTCGGACAGGGCACCAAGGTG | ||
| GAGATCAAAGGCGGCGGCGGAAGTGGAGGAGGAGGCTCAGGCGGAGGAGGGAGCGAGGTTCAGCTGGTG | ||
| GAGTCTGGCGGTGGCCTGGTGCAGCCAGGGGGCTCACTCCGTTTGTCCTGTGCAGCTTCTGGCTACTCC | ||
| TTTACCGGCTACACTATGAACTGGGTGCGTCAGGCCCCAGGTAAGGGCCTGGAATGGGTTGCACTGATT | ||
| AATCCTACCAAAGGTGTTAGTACCTACAACCAGAAGTTCAAGGACCGTTTCACTATAAGCGTAGATAAA | ||
| TCCAAAAACACAGCCTACCTGCAAATGAACAGCCTGCGTGCTGAGGACACTGCCGTCTATTATTGTGCT | ||
| AGAAGCGGATACTACGGCGATAGTGACTGGTATTTTGACGTGTGGGGTCAAGGAACCCTGGTCACCGTC | ||
| TCCTCGACATCTGGCGGCGGAGGATCTCTGGAATCTGGACAGGTGCTGCTGGAAAGCAACATCAAGGTG | ||
| CTGCCCACCTGGTCTACCCCAGTTCAGCCTATGGCTCTGATTGTGCTTGGCGGAGTTGCCGGCCTGCTG | ||
| CTCTTTATCGGCCTGGGCATCTTCTTTTGCGTGCGGTGCAGACATCGGCGGAGACAGGCTGAGAGAATG | ||
| AGCCAGATCAAGCGGCTGCTGAGCGAGAAGAAAACCTGTCAGTGCCCTCACCGGTTCCAGAAAACATGC | ||
| AGCCCCATC | ||
| 147 | Amino Acid | MALPVTALLLPLALLLHAARPEVQLVESGGGLVQPGGSLRLSCAASRNIFSLYRVDWYRQAPGKGLELV |
| AGSTSGGTTTYADAVKGRFTISTDNVKDTLYLQMNSLRAEDTAVYYCHAHDHWRDSWGQGTLVTVSSEQ | ||
| KLISEEDLNPGGGGGSGGGGSGGGGSGGGGSGSMDIQMTQSPSSLSASVGDRVTITCRASQDIRNYLNW | ||
| YQQKPGKAPKLLIYYTSRLESGVPSRESGSGSGTDYTLTISSLQPEDFATYYCQQGNTLPWTFGQGTKV | ||
| EIKGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCAASGYSFTGYTMNWVRQAPGKGLEWVALI | ||
| NPTKGVSTYNQKFKDRFTISVDKSKNTAYLQMNSLRAEDTAVYYCARSGYYGDSDWYFDVWGQGTLVTV | ||
| SSTSGGGGSLESGQVLLESNIKVLPTWSTPVQPMALIVLGGVAGLLLFIGLGIFFCVRCRHRRRQAERM | ||
| SQIKRLLSEKKTCQCPHRFQKTCSPI | ||
| 148 | Nucleotide | ATGGCTCTGCCTGTGACAGCTCTGTTGCTGCCTCTGGCTCTGCTGCTGCATGCTGCTAGACCTGAGGTG |
| CAGCTGGTTGAATCTGGCGGAGGATTGGTTCAGCCTGGCGGCTCTCTGAGACTGTCTTGTGCCGCCTCT | ||
| CGGAACATCTTCAGCCTGTACAGAGTGGACTGGGTCCGACAGGCTCCTGGCAAACAGAGAGAACTGGTC | ||
| GCCGGCTCTACCTCTGGCGGCACCACAACTTATGCCGACGCTGTGAAGGGCAGATTCACCATCTCTCGG | ||
| GACAACGTGAAGAACACCCTGTACCTGCAGATGAACTCCCTGAGAGCCGAGGACACCGCCGTGTACTAC | ||
| TGTCACGCTCACGATCACTGGCGGGACTCTTGGGGACAGGGAACACTGGTCACAGTGTCCTCTGAGCAG | ||
| AAACTGATCAGCGAGGAAGATCTGAATCCTGGCGGCGGTGGAGGCAGCGGAGGTGGCGGGAGTGGCGGA | ||
| GGCGGTTCAGGGGGTGGAGGCTCTGGATCTATGGATATCCAGATGACCCAGTCCCCGAGCTCCCTGTCC | ||
| GCCTCTGTGGGCGATAGGGTCACCATCACCTGCCGTGCCAGTCAGGACATCCGTAATTATCTGAACTGG | ||
| TATCAACAGAAACCAGGAAAAGCTCCGAAACTACTGATTTACTATACCTCCCGCCTGGAGTCTGGAGTC | ||
| CCTTCTCGCTTCTCTGGTTCTGGTTCTGGGACGGATTACACTCTGACCATCAGCAGTCTGCAACCGGAA | ||
| GACTTCGCAACTTATTACTGTCAGCAAGGTAATACTCTGCCGTGGACGTTCGGACAGGGCACCAAGGTG | ||
| GAGATCAAAGGCGGCGGCGGAAGTGGAGGAGGAGGCTCAGGCGGAGGAGGGAGCGAGGTTCAGCTGGTG | ||
| GAGTCTGGCGGTGGCCTGGTGCAGCCAGGGGGCTCACTCCGTTTGTCCTGTGCAGCTTCTGGCTACTCC | ||
| TTTACCGGCTACACTATGAACTGGGTGCGTCAGGCCCCAGGTAAGGGCCTGGAATGGGTTGCACTGATT | ||
| AATCCTACCAAAGGTGTTAGTACCTACAACCAGAAGTTCAAGGACCGTTTCACTATAAGCGTAGATAAA | ||
| TCCAAAAACACAGCCTACCTGCAAATGAACAGCCTGCGTGCTGAGGACACTGCCGTCTATTATTGTGCT | ||
| AGAAGCGGATACTACGGCGATAGTGACTGGTATTTTGACGTGTGGGGTCAAGGAACCCTGGTCACCGTC | ||
| TCCTCGACATCTGGCGGCGGAGGATCTCTGGAATCTGGACAGGTGCTGCTGGAAAGCAACATCAAGGTG | ||
| CTGCCCACCTGGTCTACCCCAGTTCAGCCTATGGCTCTGATTGTGCTTGGCGGAGTTGCCGGCCTGCTG | ||
| CTCTTTATCGGCCTGGGCATCTTCTTTTGCGTGCGGTGCAGACATCGGCGGAGACAGGCTGAGAGAATG | ||
| AGCCAGATCAAGCGGCTGCTGAGCGAGAAGAAAACCTGTCAGTGCCCTCACCGGTTCCAGAAAACATGC | ||
| AGCCCCATC | ||
| 149 | Amino Acid | MALPVTALLLPLALLLHAARPEVQLVESGGGLVQPGGSLRLSCAASRNIFSLYRVDWVRQAPGKQRELV |
| AGSTSGGTTTYADAVKGRFTISRDNVKNTLYLQMNSLRAEDTAVYYCHAHDHWRDSWGQGTLVTVSSEQ | ||
| KLISEEDLNPGGGGGSGGGGSGGGGSGGGGSGSMDIQMTQSPSSLSASVGDRVTITCRASQDIRNYLNW | ||
| YQQKPGKAPKLLIYYTSRLESGVPSRESGSGSGTDYTLTISSLQPEDFATYYCQQGNTLPWTFGQGTKV | ||
| EIKGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCAASGYSFTGYTMNWVRQAPGKGLEWVALI | ||
| NPTKGVSTYNQKFKDRFTISVDKSKNTAYLQMNSLRAEDTAVYYCARSGYYGDSDWYFDVWGQGTLVTV | ||
| SSTSGGGGSLESGQVLLESNIKVLPTWSTPVQPMALIVLGGVAGLLLFIGLGIFFCVRCRHRRRQAERM | ||
| SQIKRLLSEKKTCQCPHRFQKTCSPI | ||
| 150 | Nucleotide | ATGGCTCTGCCTGTGACAGCTCTGTTGCTGCCTCTGGCTCTGCTGCTGCATGCTGCTAGACCTGAGGTG |
| CAGCTGGTTGAATCTGGCGGAGGATTGGTTCAGCCTGGCGGCTCTCTGAGACTGTCTTGTGCCGCCTCT | ||
| CGGAACATCTTCAGCCTGTACAGAGTGGACTGGTACAGACAGGCCCCTGGCAAAGGACTGGAACTGGTG | ||
| GCTGGATCTACCTCTGGCGGCACCACCACCTATGCCGATGCTGTGAAGGGCAGATTCACCATCAGCCGG | ||
| GACAACGTGAAGAACACCCTGTACCTGCAGATGAACTCCCTGAGAGCCGAGGACACCGCCGTGTACTAC | ||
| TGTCACGCTCACGATCACTGGCGGGACTCTTGGGGACAGGGAACACTGGTCACAGTGTCCTCTGAGCAG | ||
| AAACTGATCAGCGAGGAAGATCTGAATCCTGGCGGCGGTGGAGGCAGCGGAGGTGGCGGGAGTGGCGGA | ||
| GGCGGTTCAGGGGGTGGAGGCTCTGGATCTATGGATATCCAGATGACCCAGTCCCCGAGCTCCCTGTCC | ||
| GCCTCTGTGGGCGATAGGGTCACCATCACCTGCCGTGCCAGTCAGGACATCCGTAATTATCTGAACTGG | ||
| TATCAACAGAAACCAGGAAAAGCTCCGAAACTACTGATTTACTATACCTCCCGCCTGGAGTCTGGAGTC | ||
| CCTTCTCGCTTCTCTGGTTCTGGTTCTGGGACGGATTACACTCTGACCATCAGCAGTCTGCAACCGGAA | ||
| GACTTCGCAACTTATTACTGTCAGCAAGGTAATACTCTGCCGTGGACGTTCGGACAGGGCACCAAGGTG | ||
| GAGATCAAAGGCGGCGGCGGAAGTGGAGGAGGAGGCTCAGGCGGAGGAGGGAGCGAGGTTCAGCTGGTG | ||
| GAGTCTGGCGGTGGCCTGGTGCAGCCAGGGGGCTCACTCCGTTTGTCCTGTGCAGCTTCTGGCTACTCC | ||
| TTTACCGGCTACACTATGAACTGGGTGCGTCAGGCCCCAGGTAAGGGCCTGGAATGGGTTGCACTGATT | ||
| AATCCTACCAAAGGTGTTAGTACCTACAACCAGAAGTTCAAGGACCGTTTCACTATAAGCGTAGATAAA | ||
| TCCAAAAACACAGCCTACCTGCAAATGAACAGCCTGCGTGCTGAGGACACTGCCGTCTATTATTGTGCT | ||
| AGAAGCGGATACTACGGCGATAGTGACTGGTATTTTGACGTGTGGGGTCAAGGAACCCTGGTCACCGTC | ||
| TCCTCGACATCTGGCGGCGGAGGATCTCTGGAATCTGGACAGGTGCTGCTGGAAAGCAACATCAAGGTG | ||
| CTGCCCACCTGGTCTACCCCAGTTCAGCCTATGGCTCTGATTGTGCTTGGCGGAGTTGCCGGCCTGCTG | ||
| CTCTTTATCGGCCTGGGCATCTTCTTTTGCGTGCGGTGCAGACATCGGCGGAGACAGGCTGAGAGAATG | ||
| AGCCAGATCAAGCGGCTGCTGAGCGAGAAGAAAACCTGTCAGTGCCCTCACCGGTTCCAGAAAACATGC | ||
| AGCCCCATC | ||
| 151 | Amino Acid | MALPVTALLLPLALLLHAARPEVQLVESGGGLVQPGGSLRLSCAASRNIFSLYRVDWYRQAPGKGLELV |
| AGSTSGGTTTYADAVKGRFTISRDNVKNTLYLQMNSLRAEDTAVYYCHAHDHWRDSWGQGTLVTVSSEQ | ||
| KLISEEDLNPGGGGGSGGGGSGGGGSGGGGSGSMDIQMTQSPSSLSASVGDRVTITCRASQDIRNYLNW | ||
| YQQKPGKAPKLLIYYTSRLESGVPSRFSGSGSGTDYTLTISSLQPEDFATYYCQQGNTLPWTFGQGTKV | ||
| EIKGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCAASGYSFTGYTMNWVRQAPGKGLEWVALI | ||
| NPTKGVSTYNQKFKDRFTISVDKSKNTAYLQMNSLRAEDTAVYYCARSGYYGDSDWYFDVWGQGTLVTV | ||
| SSTSGGGGSLESGQVLLESNIKVLPTWSTPVQPMALIVLGGVAGLLLFIGLGIFFCVRCRHRRRQAERM | ||
| SQIKRLLSEKKTCQCPHRFQKTCSPI | ||
| 152 | Nucleotide | ATGGCTCTGCCTGTGACAGCTCTGTTGCTGCCTCTGGCTCTGCTGCTGCATGCTGCTAGACCTGAGGTG |
| CAGCTGGTTGAATCTGGCGGAGGATTGGTTCAGCCTGGCGGCTCTCTGAGACTGTCTTGTGCCGCCTCT | ||
| CGGAACATCTTCAGCCTGTACAGAGTGGACTGGGTCCGACAGGCTCCTGGCAAAGGACTGGAACTGGTG | ||
| GCTGGCTCTACCTCTGGCGGCACCACAACCTATGCCGATGCTGTGAAGGGCAGATTCACCATCAGCCGG | ||
| GACAACGTGAAGAACACCCTGTACCTGCAGATGAACTCCCTGAGAGCCGAGGACACCGCCGTGTACTAC | ||
| TGTCACGCTCACGATCACTGGCGGGACTCTTGGGGACAGGGAACACTGGTCACAGTGTCCTCTGAGCAG | ||
| AAACTGATCAGCGAGGAAGATCTGAATCCTGGCGGCGGTGGAGGCAGCGGAGGTGGCGGGAGTGGCGGA | ||
| GGCGGTTCAGGGGGTGGAGGCTCTGGATCTATGGATATCCAGATGACCCAGTCCCCGAGCTCCCTGTCC | ||
| GCCTCTGTGGGCGATAGGGTCACCATCACCTGCCGTGCCAGTCAGGACATCCGTAATTATCTGAACTGG | ||
| TATCAACAGAAACCAGGAAAAGCTCCGAAACTACTGATTTACTATACCTCCCGCCTGGAGTCTGGAGTC | ||
| CCTTCTCGCTTCTCTGGTTCTGGTTCTGGGACGGATTACACTCTGACCATCAGCAGTCTGCAACCGGAA | ||
| GACTTCGCAACTTATTACTGTCAGCAAGGTAATACTCTGCCGTGGACGTTCGGACAGGGCACCAAGGTG | ||
| GAGATCAAAGGCGGCGGCGGAAGTGGAGGAGGAGGCTCAGGCGGAGGAGGGAGCGAGGTTCAGCTGGTG | ||
| GAGTCTGGCGGTGGCCTGGTGCAGCCAGGGGGCTCACTCCGTTTGTCCTGTGCAGCTTCTGGCTACTCC | ||
| TTTACCGGCTACACTATGAACTGGGTGCGTCAGGCCCCAGGTAAGGGCCTGGAATGGGTTGCACTGATT | ||
| AATCCTACCAAAGGTGTTAGTACCTACAACCAGAAGTTCAAGGACCGTTTCACTATAAGCGTAGATAAA | ||
| TCCAAAAACACAGCCTACCTGCAAATGAACAGCCTGCGTGCTGAGGACACTGCCGTCTATTATTGTGCT | ||
| AGAAGCGGATACTACGGCGATAGTGACTGGTATTTTGACGTGTGGGGTCAAGGAACCCTGGTCACCGTC | ||
| TCCTCGACATCTGGCGGCGGAGGATCTCTGGAATCTGGACAGGTGCTGCTGGAAAGCAACATCAAGGTG | ||
| CTGCCCACCTGGTCTACCCCAGTTCAGCCTATGGCTCTGATTGTGCTTGGCGGAGTTGCCGGCCTGCTG | ||
| CTCTTTATCGGCCTGGGCATCTTCTTTTGCGTGCGGTGCAGACATCGGCGGAGACAGGCTGAGAGAATG | ||
| AGCCAGATCAAGCGGCTGCTGAGCGAGAAGAAAACCTGTCAGTGCCCTCACCGGTTCCAGAAAACATGC | ||
| AGCCCCATC | ||
| 153 | Amino Acid | MALPVTALLLPLALLLHAARPEVQLVESGGGLVQPGGSLRLSCAASRNIFSLYRVDWVRQAPGKGLELV |
| AGSTSGGTTTYADAVKGRFTISRDNVKNTLYLQMNSLRAEDTAVYYCHAHDHWRDSWGQGTLVTVSSEQ | ||
| KLISEEDLNPGGGGGSGGGGSGGGGSGGGGSGSMDIQMTQSPSSLSASVGDRVTITCRASQDIRNYLNW | ||
| YQQKPGKAPKLLIYYTSRLESGVPSRESGSGSGTDYTLTISSLQPEDFATYYCQQGNTLPWTFGQGTKV | ||
| EIKGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCAASGYSFTGYTMNWVRQAPGKGLEWVALI | ||
| NPTKGVSTYNQKFKDRFTISVDKSKNTAYLQMNSLRAEDTAVYYCARSGYYGDSDWYFDVWGQGTLVTV | ||
| SSTSGGGGSLESGQVLLESNIKVLPTWSTPVQPMALIVLGGVAGLLLFIGLGIFFCVRCRHRRRQAERM | ||
| SQIKRLLSEKKTCQCPHRFQKTCSPI | ||
| 154 | Nucleotide | ATGGCTCTGCCTGTGACAGCTCTGTTGCTGCCTCTGGCTCTGCTGCTGCATGCTGCTAGACCTCAGGTG |
| CAGCTGGTGGAGAGCGGCGGCGGCCTGGTGCAGCCCGGCGGCAGCCTGAGGCTGAGCTGCGCCGTGAGC | ||
| AGGAACATCGCCAGCCTGTACAGGGTGGACTGGTACAGGCAGGCCCCCGGCAAGCAGAGGGAGCTGGTG | ||
| GCCGGCAGGACCAGCGGCGGCACCACCACCTACCTGGACGCCGTGGAGGGCAGGTTCACCATCAGCAGG | ||
| GACAACGTGAAGGACACCGTGTACCTGCAGATGAACAGCCTGACCCCCGAGGACACCGCCGTGTACTAC | ||
| TGCCACGCCCACGACCACTGGAGGGACAGCTGGGGCCAGGGCACCCAGGTGACCGTGAGCAGCGAGCAG | ||
| AAACTGATCAGCGAGGAAGATCTGAATCCAGGCGGAGGCGGAGGTTCTGGTGGCGGAGGAAGTGGTGGC | ||
| GGCGGATCAGGCGGCGGTGGATCTGGATCTATGGATATCCAGATGACCCAGTCCCCGAGCTCCCTGTCC | ||
| GCCTCTGTGGGCGATAGGGTCACCATCACCTGCCGTGCCAGTCAGGACATCCGTAATTATCTGAACTGG | ||
| TATCAACAGAAACCAGGAAAAGCTCCGAAACTACTGATTTACTATACCTCCCGCCTGGAGTCTGGAGTC | ||
| CCTTCTCGCTTCTCTGGTTCTGGTTCTGGGACGGATTACACTCTGACCATCAGCAGTCTGCAACCGGAA | ||
| GACTTCGCAACTTATTACTGTCAGCAAGGTAATACTCTGCCGTGGACGTTCGGACAGGGCACCAAGGTG | ||
| GAGATCAAAGGCGGCGGCGGAAGTGGAGGAGGAGGCTCAGGCGGAGGAGGGAGCGAGGTTCAGCTGGTG | ||
| GAGTCTGGCGGTGGCCTGGTGCAGCCAGGGGGCTCACTCCGTTTGTCCTGTGCAGCTTCTGGCTACTCC | ||
| TTTACCGGCTACACTATGAACTGGGTGCGTCAGGCCCCAGGTAAGGGCCTGGAATGGGTTGCACTGATT | ||
| AATCCTACCAAAGGTGTTAGTACCTACAACCAGAAGTTCAAGGACCGTTTCACTATAAGCGTAGATAAA | ||
| TCCAAAAACACAGCCTACCTGCAAATGAACAGCCTGCGTGCTGAGGACACTGCCGTCTATTATTGTGCT | ||
| AGAAGCGGATACTACGGCGATAGTGACTGGTATTTTGACGTGTGGGGTCAAGGAACCCTGGTCACCGTC | ||
| TCCTCGACATCTGGCGGCGGAGGATCTCTGGAATCTGGACAGGTGCTGCTGGAAAGCAACATCAAGGTG | ||
| CTGCCCACCTGGTCTACCCCAGTTCAGCCTATGGCTCTGATTGTGCTTGGAGGCGTGGCCGGCCTGCTG | ||
| CTGTTTATCGGCCTGGGCATCTTCTTTTGCGTGCGGTGCAGACATCGGCGGAGACAGGCTGAGAGAATG | ||
| AGCCAGATCAAGCGGCTGCTGAGCGAGAAGAAAACCTGTCAGTGCCCTCACCGGTTCCAGAAAACATGC | ||
| AGCCCCATC | ||
| 155 | Amino Acid | MALPVTALLLPLALLLHAARPQVQLVESGGGLVQPGGSLRLSCAVSRNIASLYRVDWYRQAPGKQRELV |
| AGRTSGGTTTYLDAVEGRFTISRDNVKDTVYLQMNSLTPEDTAVYYCHAHDHWRDSWGQGTQVTVSSEQ | ||
| KLISEEDLNPGGGGGSGGGGSGGGGSGGGGSGSMDIQMTQSPSSLSASVGDRVTITCRASQDIRNYLNW | ||
| YQQKPGKAPKLLIYYTSRLESGVPSRFSGSGSGTDYTLTISSLQPEDFATYYCQQGNTLPWTFGQGTKV | ||
| EIKGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCAASGYSFTGYTMNWVRQAPGKGLEWVALI | ||
| NPTKGVSTYNQKFKDRFTISVDKSKNTAYLQMNSLRAEDTAVYYCARSGYYGDSDWYFDVWGQGTLVTV | ||
| SSTSGGGGSLESGQVLLESNIKVLPTWSTPVQPMALIVLGGVAGLLLFIGLGIFFCVRCRHRRRQAERM | ||
| SQIKRLLSEKKTCQCPHRFQKTCSPI | ||
| 156 | Nucleotide | ATGGAAACCCCTGCTCAGCTGCTGTTTCTGCTGCTGCTGTGGCTGCCTGATACCACAGGCATGAGCAGA |
| GGCAGCGATCTGGGCAAGAAACTGCTGGAAGCTGCCAGAGCCGGCCAGGATGATGAAGTGCGGATTCTG | ||
| ATGGCCAACGGCGCCGATGTGAACGCCAAGGATGAGTATGGCCTGACACCTCTGTACCTGGCCACAGCT | ||
| CACGGCCACCTGGAAATTGTGGAAGTGCTGCTGAAGAATGGGGCTGACGTGAACGCCGTGGATGCCATC | ||
| GGTTTTACACCTCTGCATCTGGCTGCCTTCATCGGCCACCTTGAGATTGCCGAGGTTCTGCTGAAACAC | ||
| GGGGCAGATGTGAATGCCCAGGACAAGTTCGGCAAGACCGCCTTCGACATCAGCATCGGCAACGGCAAT | ||
| GAGGACCTGGCCGAGATCCTGCAGAAGCTGAACGAGCAGAAACTGATCAGCGAGGAAGATCTGAATCCT | ||
| GGCGGAGGCGGAGGAAGTGGTGGCGGAGGTTCTGGTGGCGGTGGATCAGGCGGTGGCGGATCTGGATCT | ||
| ATGGATATCCAGATGACCCAGTCCCCGAGCTCCCTGTCCGCCTCTGTGGGCGATAGGGTCACCATCACC | ||
| TGCCGTGCCAGTCAGGACATCCGTAATTATCTGAACTGGTATCAACAGAAACCAGGAAAAGCTCCGAAA | ||
| CTACTGATTTACTATACCTCCCGCCTGGAGTCTGGAGTCCCTTCTCGCTTCTCTGGTTCTGGTTCTGGG | ||
| ACGGATTACACTCTGACCATCAGCAGTCTGCAACCGGAAGACTTCGCAACTTATTACTGTCAGCAAGGT | ||
| AATACTCTGCCGTGGACGTTCGGACAGGGCACCAAGGTGGAGATCAAAGGCGGCGGCGGAAGTGGAGGA | ||
| GGAGGCTCAGGCGGAGGAGGGAGCGAGGTTCAGCTGGTGGAGTCTGGCGGTGGCCTGGTGCAGCCAGGG | ||
| GGCTCACTCCGTTTGTCCTGTGCAGCTTCTGGCTACTCCTTTACCGGCTACACTATGAACTGGGTGCGT | ||
| CAGGCCCCAGGTAAGGGCCTGGAATGGGTTGCACTGATTAATCCTTATAAAGGTGTTAGTACCTACAAC | ||
| CAGAAGTTCAAGGACCGTTTCACTATAAGCGTAGATAAATCCAAAAACACAGCCTACCTGCAAATGAAC | ||
| AGCCTGCGTGCTGAGGACACTGCCGTCTATTATTGTGCTAGAAGCGGATACTACGGCGATAGTGACTGG | ||
| TATTTTGACGTGTGGGGTCAAGGAACCCTGGTCACCGTCTCCTCGACATCTGGCGGCGGAGGATCTCTG | ||
| GAATCTGGACAGGTGCTGCTGGAAAGCAACATCAAGGTGCTGCCCACCTGGTCTACCCCAGTTCAGCCT | ||
| ATGGCTCTGATTGTGCTTGGCGGAGTTGCCGGCCTGCTGCTCTTTATCGGCCTGGGCATCTTCTTTTGC | ||
| GTGCGGTGCAGACATCGGCGGAGACAGGCTGAGAGAATGAGCCAGATCAAGCGGCTGCTGAGCGAGAAG | ||
| AAAACCTGTCAGTGCCCTCACCGGTTCCAGAAAACATGCAGCCCCATC | ||
| 157 | Amino Acid | METPAQLLFLLLLWLPDTTGMSRGSDLGKKLLEAARAGQDDEVRILMANGADVNAKDEYGLTPLYLATA |
| HGHLEIVEVLLKNGADVNAVDAIGFTPLHLAAFIGHLEIAEVLLKHGADVNAQDKFGKTAFDISIGNGN | ||
| EDLAEILQKLNEQKLISEEDLNPGGGGGSGGGGSGGGGSGGGGSGSMDIQMTQSPSSLSASVGDRVTIT | ||
| CRASQDIRNYLNWYQQKPGKAPKLLIYYTSRLESGVPSRFSGSGSGTDYTLTISSLQPEDFATYYCQQG | ||
| NTLPWTFGQGTKVEIKGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCAASGYSFTGYTMNWVR | ||
| QAPGKGLEWVALINPYKGVSTYNQKFKDRFTISVDKSKNTAYLQMNSLRAEDTAVYYCARSGYYGDSDW | ||
| YFDVWGQGTLVTVSSTSGGGGSLESGQVLLESNIKVLPTWSTPVQPMALIVLGGVAGLLLFIGLGIFFC | ||
| VRCRHRRRQAERMSQIKRLLSEKKTCQCPHRFQKTCSPI | ||
| 158 | Nucleotide | ATGGCTCTGCCTGTGACAGCTCTGTTGCTGCCTCTGGCTCTGCTGCTGCATGCCGCCAGACCTGATATC |
| CAGATGACCCAGACAACAAGCAGCCTGAGCGCCTCTCTGGGCGATAGAGTGACAATCAGCTGTCGGGCC | ||
| AGCCAGGACATCAGCAAGTACCTGAACTGGTATCAGCAGAAACCCGACGGCACCGTGAAGCTGCTGATC | ||
| TACCACACAAGCAGACTGCACAGCGGCGTGCCAAGCAGATTTTCTGGCAGCGGCTCTGGCACCGACTAC | ||
| AGCCTGACCATCAGCAACCTGGAACAAGAGGATATCGCTACCTACTTCTGCCAGCAAGGCAACACCCTG | ||
| CCTTACACCTTTGGCGGAGGCACCAAGCTGGAAATCACAGGCTCTACAAGCGGCAGCGGAAAGCCTGGA | ||
| TCTGGCGAGGGATCTACCAAGGGCGAAGTGAAACTGCAAGAGTCTGGCCCTGGACTGGTGGCCCCTTCT | ||
| CAGTCTCTGTCTGTGACCTGTACCGTCAGCGGAGTGTCTCTGCCTGATTACGGCGTGTCCTGGATCCGG | ||
| CAGCCTCCTAGAAAAGGACTGGAATGGCTGGGCGTGATCTGGGGCAGCGAGACAACCTACTACAACAGC | ||
| GCCCTGAAGTCCCGGCTGACAATCATCAAGGACAACTCCAAGAGCCAGGTGTTCCTGAAGATGAACAGC | ||
| CTGCAGACCGACGACACCGCCATCTACTACTGCGCCAAGCACTACTACTACGGCGGCAGCTACGCCATG | ||
| GATTATTGGGGCCAGGGCACCAGCGTGACAGTGTCTAGCGAGCAGAAGCTGATCTCCGAGGAAGATCTG | ||
| AATCCAGGCGGAGGCGGAGGTTCTGGTGGCGGAGGAAGTGGTGGCGGCGGATCAGGCGGCGGTGGATCT | ||
| GGATCTATGGATATCCAGATGACCCAGTCCCCGAGCTCCCTGTCCGCCTCTGTGGGCGATAGGGTCACC | ||
| ATCACCTGCCGTGCCAGTCAGGACATCCGTAATTATCTGAACTGGTATCAACAGAAACCAGGAAAAGCT | ||
| CCGAAACTACTGATTTACTATACCTCCCGCCTGGAGTCTGGAGTCCCTTCTCGCTTCTCTGGTTCTGGT | ||
| TCTGGGACGGATTACACTCTGACCATCAGCAGTCTGCAACCGGAAGACTTCGCAACTTATTACTGTCAG | ||
| CAAGGTAATACTCTGCCGTGGACGTTCGGACAGGGCACCAAGGTGGAGATCAAAGGCGGCGGCGGAAGT | ||
| GGAGGAGGAGGCTCAGGCGGAGGAGGGAGCGAGGTTCAGCTGGTGGAGTCTGGCGGTGGCCTGGTGCAG | ||
| CCAGGGGGCTCACTCCGTTTGTCCTGTGCAGCTTCTGGCTACTCCTTTACCGGCTACACTATGAACTGG | ||
| GTGCGTCAGGCCCCAGGTAAGGGCCTGGAATGGGTTGCACTGATTAATCCTACCAAAGGTGTTAGTACC | ||
| TACAACCAGAAGTTCAAGGACCGTTTCACTATAAGCGTAGATAAATCCAAAAACACAGCCTACCTGCAA | ||
| ATGAACAGCCTGCGTGCTGAGGACACTGCCGTCTATTATTGTGCTAGAAGCGGATACTACGGCGATAGT | ||
| GACTGGTATTTTGACGTGTGGGGTCAAGGAACCCTGGTCACCGTCTCCTCGACATCTGGCGGCGGAGGA | ||
| TCTCTGGAATCTGGACAGGTGCTGCTGGAAAGCAACATCAAGGTGCTGCCCACCTGGTCTACCCCAGTT | ||
| CAGCCTATGGCTCTGATTGTGCTTGGAGGCGTGGCCGGCCTGCTGCTGTTTATCGGCCTGGGCATCTTC | ||
| TTTTGCGTGCGGTGCAGACATCGGCGGAGACAGGCTGAGAGAATGAGCCAGATCAAGCGGCTGCTGAGC | ||
| GAGAAGAAAACCTGTCAGTGCCCTCACCGGTTCCAGAAAACATGCAGCCCCATC | ||
| 159 | Amino Acid | MALPVTALLLPLALLLHAARPDIQMTQTTSSLSASLGDRVTISCRASQDISKYLNWYQQKPDGTVKLLI |
| YHTSRLHSGVPSRESGSGSGTDYSLTISNLEQEDIATYFCQQGNTLPYTFGGGTKLEITGSTSGSGKPG | ||
| SGEGSTKGEVKLQESGPGLVAPSQSLSVTCTVSGVSLPDYGVSWIRQPPRKGLEWLGVIWGSETTYYNS | ||
| ALKSRLTIIKDNSKSQVFLKMNSLQTDDTAIYYCAKHYYYGGSYAMDYWGQGTSVTVSSEQKLISEEDL | ||
| NPGGGGGSGGGGSGGGGSGGGGSGSMDIQMTQSPSSLSASVGDRVTITCRASQDIRNYLNWYQQKPGKA | ||
| PKLLIYYTSRLESGVPSRFSGSGSGTDYTLTISSLQPEDFATYYCQQGNTLPWTFGQGTKVEIKGGGGS | ||
| GGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCAASGYSFTGYTMNWVRQAPGKGLEWVALINPTKGVST | ||
| YNQKFKDRFTISVDKSKNTAYLQMNSLRAEDTAVYYCARSGYYGDSDWYFDVWGQGTLVTVSSTSGGGG | ||
| SLESGQVLLESNIKVLPTWSTPVQPMALIVLGGVAGLLLFIGLGIFFCVRCRHRRRQAERMSQIKRLLS | ||
| EKKTCQCPHRFQKTCSPI | ||
Claims
What is claimed is:
1. A Guanylate Cyclase 2C (GUCY2C) T cell-antigen coupler (GUCY2C-TAC) protein, comprising:
(a) a first polypeptide comprising a GUCY2C-binding domain comprising:
(i) a CDR1 having the amino acid sequence of SEQ ID NO: 72, a CDR2 having the amino acid sequence of SEQ ID NO: 73, and a CDR3 having the amino acid sequence of SEQ ID NO: 74; or
(ii) a CDR1 having the amino acid sequence of SEQ ID NO: 75, a CDR2 having the amino acid sequence of SEQ ID NO: 76, and a CDR3 having the amino acid sequence of SEQ ID NO: 77;
(b) a second polypeptide comprising an antigen-binding domain that binds a protein associated with a TCR complex; and
(c) a third polypeptide comprising a TCR co-receptor cytosolic domain and transmembrane domain;
wherein, the first polypeptide, the second polypeptide, and the third polypeptide are fused directly to each other, or joined by at least one linker.
2. The GUCY2C-TAC protein of claim 1, wherein the GUCY2C-binding domain comprises a CDR1 having the amino acid sequence of SEQ ID NO: 72, a CDR2 having the amino acid sequence of SEQ ID NO: 73, and a CDR3 having the amino acid sequence of SEQ ID NO: 74.
3. The GUCY2C-TAC protein of claim 1 or 2, wherein the GUCY2C-binding domain is a nanobody.
4. The GUCY2C-TAC protein of any one of claims 1-3, wherein the GUCY2C-binding domain comprises an amino acid sequence at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to an amino acid sequence selected from the group consisting of SEQ ID NOs: 53-62.
5. The GUCY2C-TAC protein of any one of claims 1-4, wherein the GUCY2C-binding domain comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 53-62.
6. The GUCY2C-TAC protein of claim 1, wherein the GUCY2C-binding domain comprises a CDR1 having the amino acid sequence of SEQ ID NO: 75, a CDR2 having the amino acid sequence of SEQ ID NO: 76, and a CDR3 having the amino acid sequence of SEQ ID NO: 77.
7. The GUCY2C-TAC protein of claim 6, wherein the GUCY2C-binding domain is a nanobody.
8. The GUCY2C-TAC protein of claim 6 or 7, wherein the GUCY2C-binding domain comprises an amino acid sequence at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to an amino acid sequence selected from the group consisting of SEQ ID NOs: 63-71.
9. The GUCY2C-TAC protein of any one of claims 6-8, wherein the GUCY2C-binding domain comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 63-71.
10. The GUCY2C-TAC protein of any one of claims 1-9, wherein the first polypeptide, the second polypeptide, and the third polypeptide are in order from N-terminus to C-terminus.
11. The GUCY2C-TAC protein of any one of claims 1-10, wherein the protein associated with the TCR complex is a CD3 protein.
12. The GUCY2C-TAC protein of claim 11, wherein the CD3 protein is a CD3γ protein, CD36 protein and/or CD3ε protein.
13. The GUCY2C-TAC protein of claim 12, wherein the CD3 protein is a CD3ε protein.
14. The GUCY2C-TAC protein of any one of claims 1-13, wherein the antigen-binding domain that binds the protein associated with the TCR complex is derived from an antibody selected from UCHT1 OKT3, F6A, and L2K.
15. The GUCY2C-TAC protein of claim 14, wherein the antigen-binding domain that binds the protein associated with the TCR complex is a UCHT1 antigen-binding domain.
16. The GUCY2C-TAC protein of claim 15, wherein the UCHT1 antigen-binding domain is an scFv of UCHT1.
17. The GUCY2C-TAC protein of any one of claims 14-16, wherein the UCHT1 antigen-binding domain comprises a humanized variant of UCHT1 (huUCHT1).
18. The GUCY2C-TAC protein of claim 17, wherein the UCHT1 antigen-binding domain comprises a humanized variant of UCHT1 comprising a Y to T mutation at a position corresponding to amino acid 177 of SEQ ID NO: 40 (huUCHT1 (Y177T)).
19. The GUCY2C-TAC protein of any one of claims 1-18, wherein the antigen-binding domain that binds the protein associated with the TCR complex comprises an amino acid sequence having at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence identity with SEQ ID NO: 32 (UCHT1), SEQ ID NO: 44 (UCHT1 (Y182T)), SEQ ID NO: 40 (huUCHT1), or SEQ ID NO: 42 (huUCHT1 (Y177T)).
20. The GUCY2C-TAC protein of any one of claims 1-18, wherein the CDR sequences of the antigen-binding domain that binds the protein associated with the TCR complex have 100% identity with the CDR sequences of the amino acid sequence of SEQ ID NO: 32 (UCHT1), SEQ ID NO: 44 (UCHT1 (Y182T)), SEQ ID NO: 40 (huUCHT1), or SEQ ID NO: 42 (huUCHT1 (Y177T)).
21. The GUCY2C-TAC protein of any one of claims 1-18, wherein the CDR sequences of the antigen-binding domain that binds the protein associated with the TCR complex have 100% identity with the CDR sequences of the amino acid sequence of SEQ ID NO: 32 (UCHT1), SEQ ID NO: 44 (UCHT1 (Y182T)), SEQ ID NO: 40 (huUCHT1), or SEQ ID NO: 42 (huUCHT1 (Y177T)), and the non-CDR sequences of the antigen-binding domain that binds the protein associated with the TCR complex have at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the non-CDR sequences of the amino acid sequence of SEQ ID NO: 32 (UCHT1), SEQ ID NO: 44 (UCHT1 (Y182T)), SEQ ID NO: 40 (huUCHT1), or SEQ ID NO: 42 (huUCHT1 (Y177T)).
22. The GUCY2C-TAC protein of any one of claims 1-21, wherein the transmembrane domain is a CD4 transmembrane domain and the cytosolic domain is a CD4 cytosolic domain.
23. The GUCY2C-TAC protein of claim 22, wherein the transmembrane and cytosolic domain comprise an amino acid sequence having at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence identity with the amino acid sequence of SEQ ID NO: 46 (CD4 transmembrane and cytosolic domain).
24. The GUCY2C-TAC protein of any one of claims 1-23, wherein the transmembrane domain is a CD8 transmembrane domain and the cytosolic domain is a CD8 cytosolic domain.
25. The GUCY2C-TAC protein of any one of claims 1-24, wherein the component encoded by (a) and the component encoded by (c) are fused to the component encoded by (b).
26. The GUCY2C-TAC protein of any one of claims 1-24, wherein the component encoded by (b) and the component encoded by (c) are fused to the component encoded by (a).
27. The GUCY2C-TAC protein of any one of claims 1-26, wherein at least one linker joins the component encoded by (a) to the component encoded by (b).
28. The GUCY2C-TAC protein of claim 27, wherein the at least one linker is a glycine and/or serine-rich linker, a large protein domain, a long helix structure, or a short helix structure.
29. The GUCY2C-TAC protein of claim 27 or 28, wherein the at least one linker comprises an amino acid sequence having at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence identity with the amino acid sequence of SEQ ID NO: 26 ((G4S)4-based linker), SEQ ID NO: 28 (G4S-based linker), SEQ ID NO: 14 (CD4 based linker), SEQ ID NO: 12 (short helix connector), SEQ ID NO: 14 (long helix connector), SEQ ID NO: 16 (large domain connector), or SEQ ID NO: 24 ((G4S)3 flexible linker).
30. The GUCY2C-TAC protein of any one of claims 1-29, wherein the GUCY2C-TAC protein does not comprise a co-stimulatory domain.
31. The GUCY2C-TAC protein of any one of claims 1-30, wherein the GUCY2C-TAC protein does not comprise an activation domain.
32. The GUCY2C-TAC protein of any one of claims 1-31, wherein the GUCY2C-TAC protein further comprises a leader sequence.
33. The GUCY2C-TAC protein of claim 32, wherein the leader sequence comprises an amino acid sequence having at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence identity with the amino acid sequence of SEQ ID NO: 2 (muIgG leader), SEQ ID NO: 18 (huIgG leader), SEQ ID NO: 20 (huCD8a-1 leader) or SEQ ID NO: 30 (huCD8a-2 leader).
34. A GUCY2C TAC protein comprising an amino acid sequence having at least 80% sequence identity with the amino acid sequence of any one of SEQ ID NOs: 79, 81, 83, 85, 87, 89, 91, 93, 95, 97, 99, 101, 103, 105, 107, 109, 111, 113, 115, 117, 119, 121, 123, 125, 127, 129, 131, 133, 135, 137, 139, 141, 143, 145, 147, 149, 151, and 153.
35. A GUCY2C TAC protein comprising an amino acid sequence according to the amino acid sequence of any one of SEQ ID NOs: 79, 81, 83, 85, 87, 89, 91, 93, 95, 97, 99, 101, 103, 105, 107, 109, 111, 113, 115, 117, 119, 121, 123, 125, 127, 129, 131, 133, 135, 137, 139, 141, 143, 145, 147, 149, 151, and 153.
36. A GUCY2C TAC protein comprising an amino acid sequence having at least 80% sequence identity with the amino acid sequence of SEQ ID NO: 131, A GUCY2C TAC protein comprising an amino acid sequence according to the amino acid sequence of SEQ ID NO: 131.
37. A nucleic acid sequence encoding the GUCY2C TAC protein of any one of claims 1-36.
38. The nucleic acid sequence of claim 37, wherein the nucleic acid comprises a sequence having at least 80% sequence identity with the nucleic acid sequence of any one of SEQ ID NOs: 78, 80, 82, 84, 86, 88, 90, 92, 94, 96, 98, 100, 102, 104, 106, 108, 110, 112, 114, 116, 118, 120, 122, 124, 126, 128, 130, 132, 134, 136, 138, 140, 142, 144, 146, 148, 150, and 152.
39. The nucleic acid sequence of claim 37 or 38, wherein the nucleic acid sequence comprises the nucleic acid sequence of any one of SEQ ID NOs: 78, 80, 82, 84, 86, 88, 90, 92, 94, 96, 98, 100, 102, 104, 106, 108, 110, 112, 114, 116, 118, 120, 122, 124, 126, 128, 130, 132, 134, 136, 138, 140, 142, 144, 146, 148, 150, and 152.
40. A T cell expressing the GUCY2C-TAC protein of any one of claims 1-36.
41. A T cell comprising the nucleic acid sequence of any one of claims 37-39.
42. A pharmaceutical composition comprising the T cell of claim 40 or 41, and a pharmaceutically acceptable excipient.
43. A method of treating a GUCY2C-expressing cancer in an individual in need thereof, comprising administering to the individual the pharmaceutical composition of claim 42.
44. The method of claim 43, wherein the cancer is a solid cancer.
45. The method of claim 43 or 44, wherein the cancer is a colorectal cancer, a gastric cancer, a gastroesophageal junction cancer, an esophageal cancer, or a pancreatic cancer.
46. The method of claim 43 or 44, wherein the cancer is a primary colorectal cancer, a primary gastric cancer, a primary gastroesophageal junction cancer, a primary esophageal cancer, or a primary pancreatic cancer.
47. The method of claim 43 or 44, wherein the cancer is a metastatic colorectal cancer, a metastatic gastric cancer, a metastatic gastroesophageal junction cancer, a metastatic esophageal cancer, or a metastatic pancreatic cancer.