US 2012/0003201 A1Application
VAULT AGENTS FOR CHRONIC KIDNEY DISEASE
Publication Date:2012-01-05
•25 Claims
•18 Drawing Sheets
Abstract
The invention relates to compositions of vault complexes containing cell adhesion inhibiting agents, such as a RGD-peptide, and methods of using the vault complexes in the treatment of diseases, such as chronic kidney disease.
Metadata
Inventors
- Susanne B. Nicholas
- Leonard H. Rome
- Valerie A. Kickhoefer
Application Information
Application Number:US 13/092,085
Filing Date:2011-04-21
Priority Date:2010-04-21
Classifications
IPC:
A61K38/45C07K5/12C07K7/00A61P13/12C12N9/96A61K38/06A61K38/12C07K5/09C07K19/00
Patent Drawings (18 sheets)
Description
CROSS REFERENCE TO RELATED APPLICATIONS
[0001] This application claims the benefit of U.S. Provisional Application No. 61/326,518, filed Apr. 21, 2010, the entire disclosure of which is hereby incorporated by reference in its entirety for all purposes.
STATEMENT REGARDING FEDERALLY SPONSORED RESEARCH OR DEVELOPMENT
[0002] This invention was made with support from the Government under Grant No. K08DK059343 awarded by the National Institutes of Health/National Institute of Diabetes and Digestive Kidney Diseases. The Government has certain rights in this invention.
BACKGROUND OF THE INVENTION
[0003] 1. Field of the Invention
[0004] The present invention relates generally to non-viral compositions and methods useful for the cellular delivery of one or more molecules of interest. In various embodiments, vault complexes are described which comprise an agent which modifies cell adhesion, for example by inhibiting cell adhesion. Also included in the invention is the use of the compositions as cellular delivery agents for the treatment of diseases, for example chronic kidney disease.
[0005] 2. Description of the Related Art
[0006] Vaults are cytoplasmic ubiquitous ribonucleoprotein particles first described in 1986 that are found in all eukaryotic cells (Kedersha et al., J Cell Biol, 103(3):699-709 (1986)). Native vaults are 12.9±1 MDa ovoid spheres with overall dimensions of approximately 40 nm in width and 70 nm in length (Kong et al., Structure, 7(4):371-379 (1999); Kedersha et al., J Cell Biol, 112(2):225-235 (1991)), present in nearly all-eukaryotic organisms with between 104 and 107 particles per cell (Suprenant, Biochemistry, 41(49):14447-14454 (2002)). Despite their cellular abundance, vault function remains elusive although they have been linked to many cellular processes, including the innate immune response, multidrug resistance in cancer cells, multifaceted signaling pathways, and intracellular transport (Berger et al., Cell Mol Life Sci, 66(1):43-61 (2009)).
[0007] Vaults are highly stable structures in vitro, and a number of studies indicate that the particles are non-immunogenic (Champion et al., PLoS One, 4(4):e5409 (2009)). Vaults can be engineered and expressed using a baculovirus expression system and heterologous proteins can be encapsulated inside of these recombinant particles using a protein-targeting domain termed INT for vault INTeraction. Several heterologous proteins have been fused to the INT domain (e.g. fluorescent and enzymatic proteins) and these fusion proteins are expressed in the recombinant vaults and retain their native characteristics, thus conferring new properties onto these vaults (Stephen et al., J Biol Chem, 276(26):23217-23220 (2001); Kickhoefer et al., Proc Natl Acad Sci USA, 102(12):4348-4352 (2005)).
[0008] Vaults are generally described in U.S. Pat. No. 7,482,319, filed on Mar. 10, 2004; U.S. application Ser. No. 12/252,200, filed on Oct. 15, 2008; International Application No. PCT/US2004/007434, filed on Mar. 10, 2004; U.S. Provisional Application No. 60/453,800, filed on Mar. 20, 2003; U.S. Pat. No. 6,156,879, filed on Jun. 3, 1998; U.S. Pat. No. 6,555,347, filed on Jun. 28, 2000; U.S. Pat. No. 6,110,740, filed on Mar. 26, 1999; International Application No. PCT/US1999/06683, filed on Mar. 26, 1999; U.S. Provisional App. No. 60/079,634, filed on Mar. 27, 1998; and International Application No. PCT/US1998/011348, filed on Jun. 3, 1998. Vault compositions for immunization against chlamydia genital infection are described in U.S. application Ser. No. 12/467,255, filed on May 15, 2009. The entire contents of these applications are incorporated by reference in their entirety for all purposes.
[0009] Cellular adhesion is the binding of a cell to a surface, extracellular matrix, or another cell using cell adhesion molecules such as integrins, selectins, cadherins, and immunoglobulin-like adhesion molecules.
[0010] Integrins are non-covalently linked heterodimers of alpha and beta subunits. They are transmembrane proteins that are constitutively expressed, but require activation in order to bind their ligands. 15 α subunits and 8 β subunits have been identified. These can combine in various ways to form different types of integrin receptors. In many cases, one β subunit combines with several different a subunits to form a subfamily of integrin receptors.
[0011] The cadherins are calcium-dependent adhesion molecules. The three most common cadherins are neural (N)-cadherin, placental (P)-cadherin, and epithelial (E)-cadherin. All three belong to the classical cadherin subfamily. There are also desmosomal cadherins and proto-cadherins. Cadherins are involved in embryonic development and tissue organization and exhibit homophilic adhesion. The extracellular domain consists of several cadherin repeats, each capable of binding a calcium ion. When calcium is bound, the extracellular domain has a rigid, rod-like structure. Following the transmembrane domain, the intracellular domain is highly conserved. The intracellular domain is capable of binding catenins. The adhesive properties of the cadherins have been shown to be dependent upon the ability of the intracellular domain to interact with cytoplasmic proteins such as the catenins.
[0012] The selectins are a family of divalent cation dependent glycoproteins. They are carbohydrate-binding proteins, binding fucosylated carbohydrates, especially, sialylated Lewis(X), and mucins. The three family members include: Endothelial (E)-selectin, leukocyte (L)-selectin, and platelet (P)-selectin. The extracellular domain of each consists of a carbohydrate recognition motif, an epidermal growth factor (EGF)-like motif, and varying numbers of a short repeated domain related to complement-regulatory proteins (CRP).
[0013] The Ig superfamily CAMs are calcium-independent transmembrane glycoproteins. Members of the Ig superfamily include the intercellular adhesion molecules (ICAMs), vascular-cell adhesion molecule (VCAM-1), platelet-endothelial-cell adhesion molecule (PECAM-1), and neural-cell adhesion molecule (NCAM). Each Ig superfamily CAM has an extracellular domain, which contains several Ig-like intrachain disulfide-bonded loops with conserved cysteine residues, a transmembrane domain, and an intracellular domain that interacts with the cytoskeleton. Typically, they bind integrins or other Ig superfamily CAMs.
[0014] Defects in cell adhesion molecules have been associated with disease states. For example, leukocyte adhesion deficiency (LAD) syndrome is associated with cell adhesion defects. LAD I is associated with mutations in the β2 integrin. In a severe form, no LFA-1 (αLβ2) is expressed. Patients with this form of LAD I usually die within a few years of birth unless they receive bone marrow transplantation. Patients with a less severe form of the disease express low levels of β2 (i.e., about 2-5% of normal levels) and have a moderate phenotype, but experience numerous types of infections.
[0015] Chronic kidney disease (CKD) is a progressive loss in renal function over a period of time. The most common causes of CKD are diabetes mellitus, hypertension, and glomerulonephritis, which cause approximately 75% of all adult cases. To date, there are few treatment options for diabetic nephropathy (DN), the primary cause of chronic kidney disease and end stage renal disease. Thus, there is a significant need in the art for innovative therapies capable of preventing or treating DN and chronic kidney disease.
SUMMARY OF THE INVENTION
[0016] In one aspect, the present invention provides a vault complex comprising a cell adhesion modifying substance. In certain embodiments, the cell adhesion modifying substance inhibits integrin binding and/or intracellular signaling. The cell adhesion modifying substance can be an RGD-containing peptide, which can be cyclic. In particular embodiments, the RGD-containing peptide is GRGDSP. In other embodiments, the cyclic RGD-containing peptide can be attached to mINT. The cyclic RGD-containing peptide can be modified. In yet further embodiments, the vault complex contains MVP or modified MVP, and can further contain VPARP or modified VPARP, or a portion of VPARP or a modified portion of VPARP.
[0017] In another aspect, the present invention provides a pharmaceutical composition for treating and/or preventing and/or causing regression of chronic kidney disease in a subject, comprising a cell adhesion modifying substance incorporated within a vault complex, and at least one pharmaceutically acceptable excipient. In certain embodiments, the cell adhesion modifying substance inhibits integrin binding and/or intracellular signaling. The cell adhesion modifying substance can be an RGD-containing peptide, which can be cyclic. In particular embodiments, the RGD-containing peptide is GRGDSP. In other embodiments, the cyclic RGD-containing peptide can be attached to mINT. The cyclic RGD-containing peptide can be modified. In yet further embodiments, the vault contains contains MVP or modified MVP, and can further contain VPARP or modified VPARP, or a portion of VARP or a modified portion of VPARP.
[0018] In a further aspect, the present invention provides a method of treating and/or preventing chronic kidney disease in a subject, by administering to the subject an effective amount of a cell adhesion modifying substance incorporated within a vault complex. The chronic kidney disease can be caused by diabetic nephropathy. In certain embodiments, the cell adhesion modifying substance inhibits integrin binding and/or intracellular signaling. The cell adhesion modifying substance can be an RGD-containing peptide, which can be cyclic. In particular embodiments, the RGD-containing peptide is GRGDSP. In other embodiments, the cyclic RGD-containing peptide can be attached to mINT. The cyclic RGD-containing peptide can be modified. In yet further embodiments, the vault complex contains MVP or modified MVP, and can further contain VPARP or modified VPARP, or a portion of VARP or a modified portion of VPARP.
BRIEF DESCRIPTION OF THE SEVERAL VIEWS OF THE DRAWINGS
[0019] These and other features, aspects, and advantages of the present invention will become better understood with regard to the following description, and accompanying drawings, where:
[0020] FIG. 1 shows that cyclic-GRGDSP vs. cyclic-GRGESP-control peptide prevented progression of early DN in type 2 (diabetic db/db vs. non-diabetic db/m) by ameliorating albumin excretion rate in a dose dependent manner (400-2400 μg/kg) after 4 weeks of treatment, *p<0.05 (n=6-9)
[0021] FIG. 2 shows that cyclic-GRGDSP vs. cyclic-GRGESP-control peptide (2400 μg/kg) prevented progression of early DN in type 2 diabetic mice by ameliorating albumin excretion rate up to 52% after 4, 8 and 12 weeks of treatment, *p<0.05 (n=7-9). There was no change in blood pressure or plasma glucose in either the diabetic or non-diabetic animals. The peptide did not alter albumin excretion rate in control type 2 diabetic animals.
[0022] FIG. 3 shows that cyclic-GRGESP vs. cyclic-GRGESP peptide (2400 μg/kg) improved renal function measured by creatinine clearance after 12 weeks of treatment, *p<0.05 (n=6-9). There was no change in creatinine clearance in the cyclic-GRGESP-control peptide treated diabetic animals
[0023] FIG. 4 shows that cyclic-GRGDSP vs. cyclic-GRGESP-control peptide prevented glomerular extracellular matrix expansion as shown by periodic acid Schiff staining, which was quantified, p<0.05. In addition, glomerular volume measured by fractional volume of expansion by electron microscopy was normalized, p<0.05 after 12 weeks of treatment.
[0024] FIG. 5 shows that cyclic-GRGDSP vs. cyclic-GRGESP control peptide (2400 μg/kg) prevented progression of DN and ameliorated albuminuria, measured as albumin-to-creatinine ratio in type 1 diabetic (diabetic Ins2Akita/+vs. non-diabetic Ins2+/+) mice after 4, 8 and 12 weeks of treatment, *p<0.05 (n=2-4)
[0025] FIG. 6 shows that cyclic-GRGDSP vs. cyclic-GRGESP-control peptide reduced glomerular expression of extracellular matrix proteins (fibronectin, collagen I and collagen IV) in type 1 diabetic mice after 12 weeks of treatment
[0026] FIG. 7 shows that cyclic-GRGDSP vs. cyclic-GRGESP-control peptide reduced albumin excretion rate up to 71% in a dose-dependent manner (untreated, 3600 and 4800 μg/kg) after 4 weeks of intraperitoneal administration to aged type 2 diabetic db/db mice. The first 2 columns show significantly increased albumin excretion rate in diabetic db/db mice at ages 21 and 25 weeks. Albumin excretion rate in non-diabetic db/m did not change. *p<0.05 (n=2-4).
[0027] FIG. 8 shows that cyclic-GRGDSP vs. cyclic-GRGESP-control peptide (untreated, 3600 and 4800 μg/kg) reduced glomerular extracellular matrix proteins (fibronectin, collagen I and collagen IV) in a dose-dependent manner, in type 2 diabetic mice after 4 weeks of treatment, *p<0.05 (n=2-4).
[0028] FIG. 9 shows that cyclic-GRGDSP vs. cyclic-GRGESP-control peptide (untreated, 3600 and 4800 μg/kg) reduced the expression of several known signaling molecules of DN in aged type 2 diabetic mice in a dose-dependent manner
[0029] FIG. 10 shows immunoblotting analysis of MVP expression. 4A. MVP protein expression in primary mesangial cells from rat kidneys. 4B. MVP protein levels in type 2 diabetic db/db and non-diabetic control db/m mice kidneys untreated or treated with RGD-containing peptides.
[0030] FIG. 11 shows the engineering a modified CGRGDSP (D-peptide) and D-vault. A cysteine linker was added to the original cyclic GRGDSP peptide to form D-peptide which is allowed to bind to free SH on the INT-domain, which is then incubated with the vault to create D-vault. A parallel experiment was performed with cyclic-GRGESP control peptide to engineer control E-vault.
[0031] FIG. 12 shows that Modified D-peptide is 3 times more potent. Cells were serum-starved for 48 h and then treated with or without various doses of RGD-containing peptides as indicated (μg/ml) for 1 h at 37° C. Cells were then transferred to fibronectin (FN)-coated 96-well plates for 1.5 h and assayed for binding to FN-plates, as described in Methods. The modified CGRGDSP peptide appeared to be 3 times more potent in inhibiting α5β1 integrin receptor binding to FN than the GRGDSP peptide at comparable dose. The RGE-containing peptides showed no inhibitory effects. (P<0.001); N=5.
[0032] FIG. 13 shows the effect of D-vault on albuminuria. D-vault and E-vault (800 μg/kg) were administered to type 2 diabetic db/db mice. Albuminuria measured as albumin-to-creatinine ratio was significantly ameliorated after 4 weeks of treatment, *p<0.05, (n=2-4).
[0033] FIG. 14 shows the effect of CRGD on signaling molecule expression. Cells were serum-starved for 48 h and then untreated or treated with or without the unmodified RGD/RGE and modified CRGD/CRGE peptide for 48 h. The expression of extracellular matrix and signaling proteins of DN was significantly reduced with the RGD/CRGD vs. RGE/CRGE peptides.
[0034] FIG. 15 shows visualization of D-vault binding to primary mesangial cells by immunofluorescence.
[0035] FIG. 16 shows visualization of vaults by electron microscopy.
[0036] FIG. 17 shows the effect of D-vaults on mesangial cell adhesion to fibronectin-coated plates. Cells were serum-starved for 48 h and then treated with or without various doses of RGD-containing peptides and vaults as indicated for 1 h at 37° C. Cells were then transferred to fibronectin (FN)-coated 96-well plates for 1.5 h and assayed for binding to FN-plates, as described in Methods. The D-vault, GL-D-vault (containing a green lantern modified D-vault for immunofluorescence imaging) blocked adhesion of mesangial cells to FN compared to the control E-vault structures, *p<0.05,
[0037] FIG. 18 shows computed models with structural similarity to cyclic GRGDSP.
DETAILED DESCRIPTION OF THE INVENTION
[0038] The descriptions of various aspects of the invention are presented for purposes of illustration, and are not intended to be exhaustive or to limit the invention to the forms disclosed. Persons skilled in the relevant art can appreciate that many modifications and variations are possible in light of the embodiment teachings.
[0039] It should be noted that the language used herein has been principally selected for readability and instructional purposes, and it may not have been selected to delineate or circumscribe the inventive subject matter. Accordingly, the disclosure is intended to be illustrative, but not limiting, of the scope of invention.
[0040] It must be noted that, as used in the specification, the singular forms “a”, “an”, and “the” include plural referents unless the context clearly dictates otherwise.
[0041] Any terms not directly defined herein shall be understood to have the meanings commonly associated with them as understood within the art of the invention. Certain terms are discussed herein to provide additional guidance to the practitioner in describing the compositions, devices, methods and the like of embodiments of the invention, and how to make or use them. It will be appreciated that the same thing can be said in more than one way. Consequently, alternative language and synonyms can be used for any one or more of the terms discussed herein. No significance is to be placed upon whether or not a term is elaborated or discussed herein. Some synonyms or substitutable methods, materials and the like are provided. Recital of one or a few synonyms or equivalents does not exclude use of other synonyms or equivalents, unless it is explicitly stated. Use of examples, including examples of terms, is for illustrative purposes only and does not limit the scope and meaning of the embodiments of the invention herein.
DEFINITIONS
[0042] Terms used in the claims and specification are defined as set forth below unless otherwise specified.
[0043] As used herein, the term “vault” or “vault particle” refers to a large cytoplasmic ribonucleoprotein (RNP) particle found in eukaryotic cells. The vault or vault particle is composed of MVP, VPARP, and/or TEP1 proteins and one or more untranslated vRNA molecules.
[0044] As used herein, the term “vault complex” refers to a vault or recombinant vault that encapsulates a small molecule or protein of interest. A vault complex can include all the components of a vault or vault particle or just a subset. A vault complex with just a subset of the components found in vaults or vault particles can also be termed a “vault-like particle”. Examples of vault-like particles include: 1) MVP without VPARP, TEP1 and vRNA; 2) MVP and either VPARP or a portion of VPARP, without TEP1 and vRNA; 3) MVP and TEP1 or a portion of TEP1 with or without the one or more than one vRNA, and without VPARP; 4) MVP without VPARP, TEP1 and vRNA, where the MVP is modified to attract a specific substance within the vault-like particle, or modified to attract the vault complex to a specific tissue, cell type or environmental medium, or modified both to attract a specific substance within the vault complex and to attract the vault particle to a specific tissue, cell type or environmental medium; and 5) MVP, and either VPARP or a portion of VPARP, or TEP1 or a portion of TEP1 with or without the one or more than one vRNA, or with both VPARP or a portion of VPARP, and TEP1, with or without the one or more than one vRNA, where one or more than one of the MVP, VPARP or portion of VPARP and TEP1 is modified to attract a specific substance within the vault-like particle, or modified to attract the vault particle to a specific tissue, cell type or environmental medium, or modified both to attract a specific substance within the vault complex and to attract the vault complex to a specific tissue, cell type or environmental medium. As used herein, a vault complex is sometimes referred to as a “vault nanoparticle”.
[0045] As used herein, the term “vault targeting domain” or “vault interaction domain” is a domain that is responsible for interaction or binding of a heterologous fusion protein with a vault protein, or interaction of a VPARP with a vault protein, such as a MVP. As used herein, the term “mINT domain” is a vault interaction domain from a vault poly ADP-ribose polymerase (VPARP) that is responsible for the interaction of VPARP with a major vault protein (MVP). The term “mINT domain” refers to a major vault protein (MVP) interaction domain.
[0046] As used herein, the term “MVP” is major vault protein. The term “cp-MVP” is a cysteine-rich peptide major vault protein.
[0047] The term “VPARP” refers to a vault poly ADP-ribose polymerase.
[0048] As used herein, the term “TEP-1” is a telomerase/vault associated protein 1.
[0049] As used herein, the term “vRNA” is an untranslated RNA molecule found in vaults.
[0050] As used herein, a “cell adhesion modifying substance” is an agent which alters the adhesion of a cell to a surface, extracellular matrix, or another cell. The modification can be either inhibitory (decreases cell adhesion) or stimulatory (increases cell adhesion).
[0051] As used herein, an “RGD-containing peptide” is a peptide or protein that contains the tri-peptide sequence Arginine-Glycine-Aspartic Acid.
[0052] As used herein, the term “vector” is a DNA or RNA molecule used as a vehicle to transfer foreign genetic material into a cell. The four major types of vectors are plasmids, bacteriophages and other viruses, cosmids, and artificial chromosomes. Vectors can include an origin of replication, a multi-cloning site, and a selectable marker.
[0053] As used herein, a “cell” includes eukaryotic and prokaryotic cells.
[0054] As used herein, the terms “organism”, “tissue” and “cell” include naturally occurring organisms, tissues and cells, genetically modified organisms, tissues and cells, and pathological tissues and cells, such as tumor cell lines in vitro and tumors in vivo.
[0055] As used herein, the term “extracellular environment” is the environment external to the cell.
[0056] As used herein, the term “in vivo” refers to processes that occur in a living organism.
[0057] A “subject” referred to herein can be any animal, including a mammal (e.g., a laboratory animal such as a rat, mouse, guinea pig, rabbit, primates, etc.), a farm or commercial animal (e.g., a cow, horse, goat, donkey, sheep, etc.), a domestic animal (e.g., cat, dog, ferret, etc.), an avian species, or a human.
[0058] The term “mammal” as used herein includes both humans and non-humans and include but is not limited to humans, non-human primates, canines, felines, murines, bovines, equines, and porcines.
[0059] As used herein, the term “human” refers to “Homo sapiens.”
[0060] As used herein, the term “sufficient amount” is an amount sufficient to produce a desired effect, e.g., an amount sufficient to modulate cell adhesion.
[0061] As used herein, the term “therapeutically effective amount” is an amount that is effective to ameliorate a symptom of a disease, such as chronic kidney disease.
[0062] A “prophylactically effective amount” refers to an amount that is effective for prophylaxis.
[0063] As used herein, the term “stimulating” refers to activating, increasing, or triggering a molecular, cellular or enzymatic activity or response in a cell or organism, e.g. cell adhesion.
[0064] As used herein, the term “inhibiting” refers to deactivating, decreasing, or shutting down a molecular, cellular or enzymatic activity or response in a cell or organism, e.g. cell adhesion.
[0065] As used herein, the term “administering” includes any suitable route of administration, as will be appreciated by one of ordinary skill in the art with reference to this disclosure, including direct injection into a solid organ, direct injection into a cell mass such as a tumor, inhalation, intraperitoneal injection, intravenous injection, topical application on a mucous membrane, or application to or dispersion within an environmental medium, and a combination of the preceding.
[0066] As used herein, the term “treating” or “treatment” refers to the reduction or elimination of symptoms of a disease, e.g., chronic kidney disease.
[0067] As used herein, the term “preventing” or “prevention” refers to the reduction or elimination of the onset of symptoms of a disease, e.g., chronic kidney disease.
[0068] As used herein, the term “regressing” or “regression” refers to the reduction or reversal of symptoms of a disease after its onset, e.g., improvements in chronic kidney disease.
[0069] As used in this disclosure, the term “modified” and variations of the term, such as “modification,” means one or more than one change to the naturally occurring sequence of MVP, VPARP or TEP1 selected from the group consisting of addition of a polypeptide sequence to the C-terminal, addition of a polypeptide sequence to the N-terminal, deletion of between about 1 and 100 amino acid residues from the C-terminal, deletion of between about 1 and 100 amino acid residues from the N-terminal, substitution of one or more than one amino acid residue that does not change the function of the polypeptide, as will be appreciated by one of ordinary skill in the art with reference to this disclosure, such as for example, an alanine to glycine substitution, and a combination of the preceding.
[0070] As used herein, the term percent “identity,” in the context of two or more nucleic acid or polypeptide sequences, refers to two or more sequences or subsequences that have a specified percentage of nucleotides or amino acid residues that are the same, when compared and aligned for maximum correspondence, as measured using one of the sequence comparison algorithms described below (e.g., BLASTP and BLASTN or other algorithms available to persons of skill) or by visual inspection. Depending on the application, the percent “identity” can exist over a region of the sequence being compared, e.g., over a functional domain, or, alternatively, exist over the full length of the two sequences to be compared.
[0071] For sequence comparison, typically one sequence acts as a reference sequence to which test sequences are compared. When using a sequence comparison algorithm, test and reference sequences are input into a computer, subsequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated. The sequence comparison algorithm then calculates the percent sequence identity for the test sequence(s) relative to the reference sequence, based on the designated program parameters.
[0072] Optimal alignment of sequences for comparison can be conducted, e.g., by the local homology algorithm of Smith & Waterman, Adv. Appl. Math. 2:482 (1981), by the homology alignment algorithm of Needleman & Wunsch, J. Mol. Biol. 48:443 (1970), by the search for similarity method of Pearson & Lipman, Proc. Nat'l. Acad. Sci. USA 85:2444 (1988), by computerized implementations of these algorithms (GAP, BESTFIT, FASTA, and TFASTA in the Wisconsin Genetics Software Package, Genetics Computer Group, 575 Science Dr., Madison, Wis.), or by visual inspection (see generally Ausubel et al., infra).
[0073] One example of an algorithm that is suitable for determining percent sequence identity and sequence similarity is the BLAST algorithm, which is described in Altschul et al., J. Mol. Biol. 215:403-410 (1990). Software for performing BLAST analyses is publicly available through the National Center for Biotechnology Information (www.ncbi.nlm.nih.gov/).
[0074] As used in this disclosure, the term “comprise” and variations of the term, such as “comprising” and “comprises,” are not intended to exclude other additives, components, integers or steps.
[0075] It must be noted that, as used in the specification and the appended claims, the singular forms “a,” “an” and “the” include plural referents unless the context clearly dictates otherwise.
[0076] Compositions of the Invention
[0077] As described in more detail below, the invention includes compositions and methods of using vault complexes. An embodiment of the invention has recombinant vaults having a MVP and an agent, e.g., an RGD-containing peptide. The vault complex can be used for delivery of a biomolecule, e.g., a peptide, to a cell or organ or subject.
[0078] Vaults and Vault Complexes
[0079] The compositions of the invention comprise a vault complex. A vault complex is a recombinant particle that encapsulates a small molecule (drug, sensor, toxin, etc.), or a protein of interest, e.g., a peptide, or a protein, including an endogenous protein, a heterologous protein, a recombinant protein, or recombinant fusion protein. Vault complexes of the invention can include an RGD-containing peptide.
[0080] Vaults, e.g., vault particles are ubiquitous, highly conserved ribonucleoprotein particles found in nearly all eukaryotic tissues and cells, including dendritic cells (DCs), endometrium, and lung, and in phylogeny as diverse as mammals, avians, amphibians, the slime mold Dictyostelium discoideum, and the protozoan Trypanosoma brucei (Izquierdo et al., Am. J. Pathol., 148(3):877-87 (1996)). Vaults have a hollow, barrel-like structure with two protruding end caps, an invaginated waist, and regular small openings surround the vault cap. These openings are large enough to allow small molecules and ions to enter the interior of the vault. Vaults have a mass of about 12.9±1 MDa (Kedersha et al., J. Cell Biol., 112(2):225-35 (1991)) and overall dimensions of about 42×42×75 nm (Kong et al., Structure, 7(4):371-9 (1999)). The volume of the internal vault cavity is approximately 50×103 nm3, which is large enough to enclose an entire ribosomal protein.
[0081] Vaults comprise three different proteins, designated MVP, VPARP and TEP1, and comprise one or more different untranslated RNA molecules, designated vRNAs. The number of vRNA can vary. For example, the rat Rattus norvegicus has only one form of vRNA per vault, while humans have three forms of vRNA per vault. The most abundant protein, major vault protein (MVP), is a 95.8 kDa protein in Rattus norvegicus and a 99.3 kDa protein in humans which is present in 96 copies per vault and accounts for about 75% of the total protein mass of the vault particle. The two other proteins, the vault poly-ADP ribose polymerase, VPARP, a 193.3 kDa protein in humans, and the telomerase/vault associated protein 1, TEP1, a 292 kDa protein in Rattus norvegicus and a 290 kDa protein in humans, are each present in between about 2 and 16 copies per vault.
[0082] VPARP, mINT Domain, and mINT Fusion Proteins
[0083] A vault poly ADP-ribose polymerase (VPARP) includes a region of about 350 amino acids that shares 28% identity with the catalytic domain of poly ADP-ribosyl polymerase, PARP, a nuclear protein that catalyzes the formation of ADP-ribose polymers in response to DNA damage. VPARP catalyzes an NAD-dependent poly ADP-ribosylation reaction, and purified vaults have poly ADP-ribosylation activity that targets MVP, as well as VPARP itself. VPARP includes a mINT domain (major vault protein (MVP) interaction domain). The mINT domain is responsible for the interaction of VPARP with a major vault protein (MVP).
[0084] A vault complex of the invention can include a mINT domain. The mINT domain is responsible for interaction of a protein of interest with a vault protein such as a MVP. In some embodiments, the mINT domain is expressed as a fusion protein with a protein of interest. Alternatively, a protein of interest can be covalently or non-covalently attached. The mINT of the vault complexes of the invention are derived from VPARP sequences. Exemplary VPARP sequences and mINT sequences can be found in Table 1. One of skill in the art understands that the mINT can have the entire naturally occurring sequence or portions of the sequence or fragments thereof. In other embodiments, the mINT has at least 50%, 60%, 70%, 80%, 90%, 95%, 96%, 97%, 98% or 99% sequence identity to any of the VPARP and/or mINT sequences disclosed in Table 1.
[0085] In one embodiment, the mINT is derived from a human VPARP, SEQ ID NO:3, GenBank accession number AAD47250, encoded by the cDNA, SEQ ID NO:5, GenBank accession number AF158255. In some embodiments, the vault targeting domain comprises or consists of the INT domain corresponding to residues 1473-1724 of human VPARP protein sequence (full human VPARP amino acid sequence is SEQ ID NO:3). In other embodiments, the vault targeting domain comprises or consists of the mINT domain comprising residues 1563-1724 (SEQ ID NO: 2) of the human VPARP protein sequence. In certain embodiments, the vault targeting domain is at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 2 or 3.
[0086] In alternative embodiments, the mINT domain is derived from TEP1 sequences. One of skill in the art understands that the mINT can have the entire naturally occurring sequence of the vault interaction domain in TEP1 or portions of the sequence or fragments thereof.
[0087] MVP
[0088] A vault complex of the invention can include an MVP. Exemplary MVP sequences can be found in Table 1. One of skill in the art understands that the MVP can have the entire naturally occurring sequence or portions of the sequence or fragments thereof. In other embodiments, the MVP has at least 50%, 60%, 70%, 80%, 90%, 95%, 96%, 97%, 98% or 99% sequence identity to any of the MVP sequences disclosed in Table 1.
[0089] In one embodiment, the MVP is human MVP, SEQ ID NO:6, GenBank accession number CAA56256, encoded by the cDNA, SEQ ID NO:7, GenBank accession number X79882. In other embodiments, the MVP is at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to the MVP sequences described herein.
[0090] In one embodiment, there is provided a vault complex comprising, consisting essentially of, or consisting of an MVP modified by adding a peptide to the N-terminal to create a one or more than one of heavy metal binding domains. In a preferred embodiment, the heavy metal binding domains bind a heavy metal selected from the group consisting of cadmium, copper, gold and mercury. In a preferred embodiment, the peptide added to the N-terminal is a cysteine-rich peptide (CP), such as for example, SEQ ID NO:8, the MVP is human MVP, SEQ ID NO:6, and the modification results in CP-MVP, SEQ ID NO:9, encoded by the cDNA, SEQ ID NO:10. These embodiments are particularly useful because vault particles consisting of CP-MVP are stable without the presence of other vault proteins.
[0091] Any of the vault complexes described herein can include MVPs or modified MVPs disclosed herein.
[0092] TEP1
[0093] In some embodiments, a vault complex of the invention can include a TEP1 protein. Exemplary TEP1 sequences can be found in Table 1. One of skill in the art understands that the TEP1 can have the entire naturally occurring sequence or portions of the sequence or fragments thereof. In other embodiments, the TEP1 has at least 50%, 60%, 70%, 80%, 90%, 95%, 96%, 97%, 98% or 99% sequence identity to any of the TEP1 sequences disclosed in Table 1.
[0094] The TEP1 can be human TEP1, SEQ ID NO:11, GenBank accession number AAC51107, encoded by the cDNA, SEQ ID NO:12, GenBank accession number U86136. Any of the vault complexes described herein can include TEP1 or modifications thereof.
[0095] vRNA
[0096] A vault complex of the invention can include a vRNA. Exemplary vRNA sequences can be found in Table 1. One of skill in the art understands that the vRNA can have the entire naturally occurring sequence or portions of the sequence or fragments thereof. In other embodiments, the vRNA has at least 50%, 60%, 70%, 80%, 90%, 95%, 96%, 97%, 98% or 99% sequence identity to any of the vRNA sequences disclosed in Table 1.
[0097] In one embodiment, the vRNA can be a human vRNA, SEQ ID NO:13, GenBank accession number AF045143, SEQ ID NO:14, GenBank accession number AF045144, or SEQ ID NO:15, GenBank accession number AF045145, or a combination of the preceding.
[0098] As will be appreciated by one of ordinary skill in the art with reference to this disclosure, the actual sequence of any of MVP, VPARP, TEP1 and vRNAs can be from any species suitable for the purposes disclosed in this disclosure, even though reference or examples are made to sequences from specific species. Further, as will be appreciated by one of ordinary skill in the art with reference to this disclosure, there are some intraspecies variations in the sequences of MVP, VPARP, TEP1 and vRNAs that are not relevant to the purposes of the present invention. Therefore, references to MVP, VPARP, TEP1 and vRNAs are intended to include such intraspecies variants.
[0099] Cell Adhesion Modifying Agents
[0100] As used herein a “cell adhesion modifying substance” is an agent which modifies cell adhesion mediated by cell adhesion proteins, including, but not limited, to integrins, cadherins, selectins, or Ig superfamily CAMs. A cell adhesion modifying agent may be a peptide, protein, pharmaceutical agent, drug, compound, or composition that is useful in modifying cell adhesion. The modifying agent may, e.g., stimulate or inhibit cell adhesion.
[0101] In one advantageous embodiment, the cell adhesion modifying agent may inhibit cell adhesion mediated by integrins.
[0102] Ligands for Integrins
[0103] Mammalian genomes contain 18 α subunit and 8 β subunit genes, and 24 different αβ combinations have been identified at the protein level. Integrins mediate cell adhesion to a number of ligands, including extracellular matrix proteins, such as fibronectin, laminin, collagen, thrombospondin, VCAM-1, among others. See, e.g., Humphries et al., J. Cell Sci., 119: 3901-3903 (2006) for a review.
[0104] A number of integrin binding ligands share in common an “RGD” peptide motif. All five αV integrins, two β1 integrins (α5, α8) and αIIbβ3 share the ability to recognize ligands containing an RGD tripeptide active site. Crystal structures of αVβ3 and αIIbβ3 complexed with RGD ligands have revealed an identical atomic basis for this interaction (Xiong et al., 2002; Xiao et al., 2004). RGD binds at an interface between the α and β subunits, the R residue fitting into a cleft in a β-propeller module in the α subunit, and the D coordinating a cation bound in a von Willebrand factor A domain in the β subunit. The RGD binding integrins bind the greatest variety of ligands, with β3 integrins binding to a large number of extracellular matrix and soluble vascular ligands.
[0105] α4β1, α4β7, α9β1, the four members of the β2 subfamily and αEβ7 recognize related sequences in their ligands. α4β1, α4β7 and α9β1 bind to an acidic motif, termed ‘LDV’, that is functionally related to RGD. Fibronectin contains the prototype LDV ligand in its type III connecting segment region, but other ligands (such as VCAM-1 and MAdCAM-1) employ related sequences.
[0106] It is thought that LDV peptides bind at the junction between the α and β subunits in a manner similar to RGD.
[0107] Four α subunits containing an α A domain (α1, α2, α10 and α11) combine with α1 and form a distinct laminin/collagen-binding subfamily.
[0108] Three α1 integrins (α3, α6 and α7), plus α6β4, are highly selective laminin receptors.
[0109] As disclosed herein, one class of cell adhesion modifying agents include peptides and proteins which comprise the “RGD” peptide sequence. Peptides containing the “RGD” motif have an inhibitory effect on cell adhesion. An exemplary RGD-peptide has the sequence GRGDSP. As discussed herein, peptides comprising “RGE”, e.g., GRGESP, are frequently used as negative controls. The peptides can be used in either a linear or cyclic form. However, in some embodiments, a cyclic form of the peptide is preferred for in vivo use as it has greater bioavailability.
[0110] RGD-Containing Peptides
[0111] Compositions for treating chronic kidney disease (CKD) are provided herein comprising a cyclized RGD (Arg-Gly-Asp)-containing peptide agent associated with a recombinant vault nanoparticle delivery vehicle. The RGD peptide agents prevent and/or reverse pathological glomerular lesions associated with diabetic nephropathy and other forms of CKD by inhibiting interactions between mesangial cell integrins and extracellular matrix proteins. For example, the RGD peptide agents have been shown to block α5β1 integrin-mediated primary mesangial cell adhesion to fibronectin (FN), the predominant extracellular matrix protein accumulated in DN, by ˜50% in vitro. The RGD peptide agent have also been shown to significantly reduce urinary albumin and mesangium expansion in type 2 diabetic db/db diabetic mice to levels observed in type 2 non-diabetic db/m control animals (FIGS. 1-4 ) and in Ins2Akita/+type 1 diabetic mice to levels observed in type 1 non-diabetic Ins2+/+ control animals (FIGS. 5-6 ). The RGD peptide agent has also been shown to cause regression of established DN in aged type 2 diabetic db/db mice (FIGS. 7-9 ). Vault nanoparticles are widely expressed in eukaryotic cells, and consist of a dynamic barrel-like structure with a hollow interior for encapsulating macromolecules. Advantageously, packaging RGD peptide agents in vault nanoparticle compositions provided herein allows for efficient, targeted delivery of the RGD peptide agents in vivo.
[0112] In some aspects, RGD-peptide agents provided herein are modified to include a free cysteine residue. For example, exemplary RGD peptide-vault nanoparticles were constructed using a modified form of the RGD peptide agent, GRGDSP, which comprises a free cysteine residue (referred to as CGRGDSP). The free cysteine was utilized to attach the RGD peptide to one or more available cysteines on the vault mINT domain. Linking RGD peptides to mINT allows the peptides to be packaged in the interior of vault nanoparticles due The exemplary RGD peptide-vault nanoparticles exhibited a consistent barrel-shaped vault structure when visualized by electron microscopy. Using a cell adhesion assay, the RGD peptide-vault nanoparticles were shown to be as efficacious as the cysteine modified RGD-peptide in inhibiting α5β1 integrin-mediated mesangial cell adhesion to FN (FIG. 17 ). The control RGE-peptide, empty vault, and the RGE-vault control showed no inhibitory effect. Interestingly, an RGD peptide comprising a free cysteine residue and RGD peptide-vault nanoparticles comprising the peptide were ˜3-times more potent than the corresponding unmodified RGD peptide (FIG. 12 ). Kinetic studies and immunoblotting analysis showed inhibition of integrin-mediated cellular signaling by TGF-β, AKT and STAT3 by CRGD peptide (FIG. 14 ).
[0113] Advantageously, cysteine-modified RGD peptides, such as CGRGDSP, are more efficient in preventing progression of early DN and/or causing regression of established lesions of DN than unmodified RGD peptides. Further, cysteine-modified RGD peptide-vault nanoparticle compositions can considerably enhance in vivo delivery of the modified RGD peptides.
[0114] In some aspects, vault nanoparticles provided herein may further comprise a targeting agent, such as an antibody or an antibody fragment, which binds selectively to a therapeutic target and/or a molecule in the vicinity of a therapeutic target. For example, in some aspects, RGD peptide-vault particles are targeted at or near the α5β1-fibronectin active site. Advantageously, targeted RGD-vault nanoparticles modulate α5β1 integrin-FN signaling and/or halt progressive albuminuria in db/db mice to a similar or greater degree than the corresponding free RGD peptides.
[0115] In some aspects, mINT can be modified to contain one or more additional cysteine residues to increase binding of the cyclic RGD peptide, allowing a higher concentration of RGD peptide to be packaged inside of the vault. For example, the vault particle, CP-MVP, contains extra cysteine residues at the N-terminus. In further aspects, cyclic RGD peptides can be linked to vault particles directly via one or more cysteine residues and/or other moieties.
[0116] In some aspects, polymers of RGD sequences are engineered into mINT and/or MVP that contain flanking sequences that would allow for the cyclization following translation to form cyclic peptides. For example, flanking zinc finger motifs would cyclize in the presence of zinc ions, or flanking poly-histidine residues would cyclize in the presence of nickel. The advantage of this approach would be that the peptides would not have to be chemically synthesized thus the therapeutic vault easier to produce for therapeutic applications.
[0117] Other cell adhesion modifying agents which are useful in the practice of aspects of the invention are known in the art, as disclosed, e.g., in Horton, Exp. Nephrology, 7: 178-184 (1999). Such agents include naturally occurring protein inhibitors and derivatives (e.g., RGD-containing snake toxins), blocking antibodies to adhesion molecules, RGD-peptides and chemical derivatives, oligosaccharide analogues (e.g., for selectin inhibition), receptor-immunoglobulin chimeras, non-peptidic mimetics, antisense and siRNA nucleic acids, among others.
[0118] Isolated Nucleic Acids and Vectors
[0119] Suitable expression vectors generally include DNA plasmids or viral vectors. Expression vectors compatible with eukaryotic cells, preferably those compatible with vertebrate cells, can be used to produce recombinant constructs for the expression of an iRNA as described herein. Eukaryotic cell expression vectors are well known in the art and are available from a number of commercial sources. Typically, such vectors are provided containing convenient restriction sites for insertion of the desired nucleic acid segment. Delivery of expression vectors can be systemic, such as by intravenous or intramuscular administration, by administration to target cells ex-planted from the patient followed by reintroduction into the patient, or by any other means that allows for introduction into a desired target cell.
[0120] Plasmids expressing a nucleic acid sequence can be transfected into target cells as a complex with cationic lipid carriers (e.g., Oligofectamine) or non-cationic lipid-based carriers (e.g., Transit-TKO™). Successful introduction of vectors into host cells can be monitored using various known methods. For example, transient transfection can be signaled with a reporter, such as a fluorescent marker, such as Green Fluorescent Protein (GFP). Stable transfection of cells ex vivo can be ensured using markers that provide the transfected cell with resistance to specific environmental factors (e.g., antibiotics and drugs), such as hygromycin B resistance.
[0121] Viral vector systems which can be utilized with the methods and compositions described herein include, but are not limited to, (a) adenovirus vectors; (b) retrovirus vectors, including but not limited to lentiviral vectors, moloney murine leukemia virus, etc.; (c) adeno-associated virus vectors; (d) herpes simplex virus vectors; (e) SV 40 vectors; (f) polyoma virus vectors; (g) papilloma virus vectors; (h) picornavirus vectors; (i) pox virus vectors such as an orthopox, e.g., vaccinia virus vectors or avipox, e.g. canary pox or fowl pox; and (j) a helper-dependent or gutless adenovirus. Replication-defective viruses can also be advantageous. Different vectors will or will not become incorporated into the cells' genome. The constructs can include viral sequences for transfection, if desired. Alternatively, the construct may be incorporated into vectors capable of episomal replication, e.g., EPV and EBV vectors. Constructs for the recombinant expression of a nucleic acid encoding a fusion protein will generally require regulatory elements, e.g., promoters, enhancers, etc., to ensure the expression of the fusion nucleic acid in target cells. Other aspects to consider for vectors and constructs are further described below.
[0122] Vectors useful for the delivery of a nucleic acid can include regulatory elements (promoter, enhancer, etc.) sufficient for expression of the nucleic acid in the desired target cell or tissue. The regulatory elements can be chosen to provide either constitutive or regulated/inducible expression. A person skilled in the art would be able to choose the appropriate regulatory/promoter sequence based on the intended use of the transgene.
[0123] In a specific embodiment, viral vectors that contain the recombinant gene can be used. For example, a retroviral vector can be used (see Miller et al., Meth. Enzymol. 217:581-599 (1993)). These retroviral vectors contain the components necessary for the correct packaging of the viral genome and integration into the host cell DNA. The nucleic acid sequences encoding a fusion protein are cloned into one or more vectors, which facilitates delivery of the nucleic acid into a patient. More detail about retroviral vectors can be found, for example, in Boesen et al., Biotherapy 6:291-302 (1994), which describes the use of a retroviral vector to deliver the mdr1 gene to hematopoietic stem cells in order to make the stem cells more resistant to chemotherapy. Other references illustrating the use of retroviral vectors in gene therapy are: Clowes et al., J. Clin. Invest. 93:644-651 (1994); Kiem et al., Blood 83:1467-1473 (1994); Salmons and Gunzberg, Human Gene Therapy 4:129-141 (1993); and Grossman and Wilson, Curr. Opin. in Genetics and Devel. 3:110-114 (1993). Lentiviral vectors contemplated for use include, for example, the HIV based vectors described in U.S. Pat. Nos. 6,143,520; 5,665,557; and 5,981,276, which are herein incorporated by reference.
[0124] Adenoviruses are also contemplated for use in delivery of isolated nucleic acids encoding fusion proteins into a cell. Adenoviruses are especially attractive vehicles for delivering genes to respiratory epithelia or for use in adenovirus-based delivery systems such as delivery to the liver, the central nervous system, endothelial cells, and muscle. Adenoviruses have the advantage of being capable of infecting non-dividing cells. Kozarsky and Wilson, Current Opinion in Genetics and Development 3:499-503 (1993) present a review of adenovirus-based gene therapy. Bout et al., Human Gene Therapy 5:3-10 (1994) demonstrated the use of adenovirus vectors to transfer genes to the respiratory epithelia of rhesus monkeys. Other instances of the use of adenoviruses in gene therapy can be found in Rosenfeld et al., Science 252:431-434 (1991); Rosenfeld et al., Cell 68:143-155 (1992); Mastrangeli et al., J. Clin. Invest. 91:225-234 (1993); PCT Publication WO94/12649; and Wang, et al., Gene Therapy 2:775-783 (1995). A suitable AV vector for expressing a nucleic acid molecule featured in the invention, a method for constructing the recombinant AV vector, and a method for delivering the vector into target cells, are described in Xia H et al. (2002), Nat. Biotech. 20: 1006-1010.
[0125] Use of Adeno-associated virus (AAV) vectors is also contemplated (Walsh et al., Proc. Soc. Exp. Biol. Med. 204:289-300 (1993); U.S. Pat. No. 5,436,146). Suitable AAV vectors for expressing the dsRNA featured in the invention, methods for constructing the recombinant AV vector, and methods for delivering the vectors into target cells are described in Samulski R et al. (1987), J. Virol. 61: 3096-3101; Fisher K J et al. (1996), J. Virol, 70: 520-532; Samulski R et al. (1989), J. Virol. 63: 3822-3826; U.S. Pat. No. 5,252,479; U.S. Pat. No. 5,139,941; International Patent Application No. WO 94/13788; and International Patent Application No. WO 93/24641, the entire disclosures of which are herein incorporated by reference.
[0126] Another preferred viral vector is a pox virus such as a vaccinia virus, for example an attenuated vaccinia such as Modified Virus Ankara (MVA) or NYVAC, an avipox such as fowl pox or canary pox.
[0127] The pharmaceutical preparation of a vector can include the vector in an acceptable diluent, or can include a slow release matrix in which the gene delivery vehicle is imbedded. Alternatively, where the complete gene delivery vector can be produced intact from recombinant cells, e.g., retroviral vectors, the pharmaceutical preparation can include one or more cells which produce the gene delivery system.
[0128] Examples of additional expression vectors that can be used in the invention include pFASTBAC expression vectors and E. coli pET28a expression vectors.
[0129] Generally, recombinant vectors capable of expressing genes for recombinant fusion proteins are delivered into and persist in target cells. The vectors or plasmids can be transfected into target cells by a transfection agent, such as Lipofectamine. Examples of cells useful for expressing the nucleic acids encoding the fusion proteins of the invention include Sf9 cells or insect larvae cells. Recombinant vaults based on expression of the MVP protein alone can be produced in insect cells. Stephen, A. G. et al. (2001). J. Biol. Chem. 276:23217:23220; Poderycki, M. J., et al. (2006). Biochemistry (Mosc). 45: 12184-12193.
[0130] Pharmaceutical Compositions of the Invention
[0131] In one embodiment, the invention provides methods using pharmaceutical compositions comprising the vault complexes of the invention. These compositions can comprise, in addition to one or more of the vault complexes, a pharmaceutically acceptable excipient, carrier, buffer, stabilizer or other materials well known to those skilled in the art. Such materials should be non-toxic and should not interfere with the efficacy of the active ingredient. The precise nature of the carrier or other material can depend on the route of administration, e.g. oral, intravenous, cutaneous or subcutaneous, nasal, intramuscular, intraperitoneal routes.
[0132] In certain embodiments, the pharmaceutical compositions that are injected intra-tumorally comprise an isotonic or other suitable carrier fluid or solution.
[0133] For intravenous, cutaneous or subcutaneous injection, or injection at the site of affliction, the active ingredient will be in the form of a parenterally acceptable aqueous solution which is pyrogen-free and has suitable pH, isotonicity and stability. Those of relevant skill in the art are well able to prepare suitable solutions using, for example, isotonic vehicles such as Sodium Chloride Injection, Ringer's Injection, Lactated Ringer's Injection. Preservatives, stabilizers, buffers, antioxidants and/or other additives can be included, as required.
[0134] In other embodiments, pharmaceutical compositions for oral administration can be in tablet, capsule, powder or liquid form. A tablet can include a solid carrier such as gelatin or an adjuvant. Liquid pharmaceutical compositions generally include a liquid carrier such as water, petroleum, animal or vegetable oils, mineral oil or synthetic oil. Physiological saline solution, dextrose or other saccharide solution or glycols such as ethylene glycol, propylene glycol or polyethylene glycol can be included.
[0135] In some embodiments, administration of the pharmaceutical compositions may be topical, pulmonary, e.g., by inhalation or insufflation of powders or aerosols, including by nebulizer; intratracheal, intranasal, epidermal and transdermal, oral or parenteral. Parenteral administration includes intravenous, intraarterial, subcutaneous, intraperitoneal or intramuscular injection or infusion; or intracranial, e.g., intraparenchymal, intrathecal or intraventricular, administration. Formulations for parenteral administration may include sterile aqueous solutions which may also contain buffers, diluents and other suitable additives. For intravenous use, the total concentration of solutes should be controlled to render the preparation isotonic.
[0136] Methods of Use
[0137] Vault complexes described herein can be used to deliver a protein of interest to a cell, a tissue, an environment outside a cell, a tumor, an organism or a subject. In one embodiment, the vault complex comprises an RGD-containing peptide, and the vault complex is introduced to the cell, tissue, or tumor. In some embodiments, the vault complex is introduced into the extracellular environment surrounding the cell. In other embodiments, the vault complex is introduced into an organism or subject. Delivery of the vault complex of the invention can include administering the vault complex to a specific tissue, specific cells, an environmental medium, or to the organism.
[0138] The methods of the invention comprise delivering a biomolecule to a cell by contacting the cell with any of the vault complexes described herein. Cells of the invention can include, but are not limited to, any eukaryotic cell, mammalian cell, or human cells, including tumor cells.
[0139] Methods of the invention include delivery of the vault complex to a subject. The delivery of a vault complex to a subject in need thereof can be achieved in a number of different ways. In vivo delivery can be performed directly by administering a vault complex to a subject. Alternatively, delivery can be performed indirectly by administering one or more vectors that encode and direct the expression of the vault complex or components of the vault complex. In one embodiment, the vault complex is administered to a mammal, such as a mouse or rat. In another embodiment, the vault complex is administered to a human.
[0140] In another embodiment, the methods of delivery of the invention include systemic injection of vault.
[0141] Methods of Treatment
[0142] The invention features a method of treating or managing disease, such as chronic kidney disease, by administering the vault complex of the invention to a subject (e.g., patient). In some embodiments, the method of the invention comprises treating or managing chronic kidney disease in a subject in need of such treatment or management, comprising administering to the subject a therapeutically effective amount of the vault complexes described herein.
[0143] The data obtained from cell culture assays and animal studies can be used in formulating a range of dosage for use in humans. For any compound used in the methods featured in the invention, the therapeutically effective dose can be estimated initially from cell culture assays. A dose may be formulated in animal models to achieve a circulating plasma concentration range of the vault complex. Such information can be used to more accurately determine useful doses in humans.
[0144] The pharmaceutical composition according to the present invention to be given to a subject, administration is preferably in a “therapeutically effective amount” or “prophylactically effective amount” (as the case can be, although prophylaxis can be considered therapy), this being sufficient to show benefit to the individual. The actual amount administered, and rate and time-course of administration, will depend on the nature and severity of protein aggregation disease being treated. Prescription of treatment, e.g. decisions on dosage etc, is within the responsibility of general practitioners and other medical doctors, and typically takes account of the disorder to be treated, the condition of the individual patient, the site of delivery, the method of administration and other factors known to practitioners. Examples of the techniques and protocols mentioned above can be found in Remington's Pharmaceutical Sciences, 16th edition, Osol, A. (ed), 1980. A composition can be administered alone or in combination with other treatments, either simultaneously or sequentially dependent upon the condition to be treated.
[0145] In certain embodiments, the dosage of vault complexes is between about 0.1 and 10,000 micrograms per kilogram of body weight or environmental medium. In another embodiment, the dosage of vault complexes is between about 1 and 1,000 micrograms per kilogram of body weight or environmental medium. In another embodiment, the dosage of vault complexes is between about 10 and 1,000 micrograms per kilogram of body weight or environmental medium. For intravenous injection and intraperitoneal injection, the dosage is preferably administered in a final volume of between about 0.1 and 10 ml. For inhalation the dosage is preferably administered in a final volume of between about 0.01 and 1 ml. As will be appreciated by one of ordinary skill in the art with reference to this disclosure, the dose can be repeated a one or multiple times as needed using the same parameters to effect the purposes disclosed in this disclosure.
[0146] For instance, the pharmaceutical composition may be administered once to a subject, or the vault complex may be administered as two, three, or more sub-doses or injections at appropriate intervals. In that case, the vault complexes can be injected in sub-doses in order to achieve the total required dosage.
[0147] The vault complexes featured in the invention can be administered in combination with other known agents effective in treatment of chronic kidney disease. An administering physician can adjust the amount and timing of vault complex administration or injection on the basis of results observed using standard measures of efficacy known in the art or described herein. The skilled artisan will also appreciate that certain factors may influence the dosage and timing required to effectively treat a subject, including but not limited to the severity of the disease or disorder, previous treatments, the general health and/or age of the subject, and other diseases present.
[0148] Methods of Preparing Vault Complexes
[0149] The methods of the invention include preparing the vault complexes described herein.
[0150] In one embodiment, the vault complexes are derived or purified from natural sources, such as mammalian liver or spleen tissue, using methods known to those with skill in the art, such as for example tissue homogenization, differential centrifugation, discontinuous sucrose gradient fractionation and cesium chloride gradient fractionation. In another embodiment, the vault complexes are made using recombinant technology.
[0151] In some embodiments, a target of interest, i.e., protein of interest, is selected for packaging in the vault complexes. The target of interest may be selected from the group consisting of an enzyme, a pharmaceutical agent, a plasmid, a polynucleotide, a polypeptide, a sensor and a combination of the preceding. In a preferred embodiment, the target of interest is a recombinant protein, e.g., a cell adhesion modifying substance, e.g., an RGD-containing peptide.
[0152] Preferably, if the target of interest is a recombinant protein, the polynucleotide sequences encoding the recombinant protein are used to generate a bacmid DNA, which is used to generate a baculovirus comprising the sequence. The baculovirus is then used to infect insect cells for protein production using an in situ assembly system, such as the baculovirus protein expression system, according to standard techniques, as will be appreciated by one of ordinary skill in the art with reference to this disclosure. Advantageously, the baculovirus protein expression system can be used to produce milligram quantities of vault complexes, and this system can be scaled up to allow production of gram quantities of vault complexes according to the present invention.
[0153] In another embodiment, the target of interest is incorporated into the provided vaults. In one embodiment, incorporation is accomplished by incubating the vaults with the target of interest at an appropriate temperature and for an appropriate time, as will be appreciated by one of ordinary skill in the art with reference to this disclosure. The vaults containing the protein of interest are then purified, such as, for example sucrose gradient fractionation, as will be appreciated by one of ordinary skill in the art with reference to this disclosure.
[0154] In other embodiments, the vaults comprising the target of interest are administered to an organism, to a specific tissue, to specific cells, or to an environmental medium. Administration is accomplished using any suitable route, as will be appreciated by one of ordinary skill in the art with reference to this disclosure.
[0155] In one embodiment, the method comprises preparing the composition of the invention by a) mixing a fusion protein comprising a RGD-containing peptide fused to a mINT generated in Sf9 cells with a rat MVP generated in Sf9 cells to generate a mixture; b) incubating the mixture for a sufficient period of time to allow packaging of the fusion protein inside of vault complexes, thereby generating the composition. Sf9 cells are infected with pVI-MVP encoding recombinant baculoviruses. Lysates containing recombinant RGD-peptide-INT and rat MVP generated in Sf-9 cells can be mixed to allow the formation of a macromolecular vault complex containing the RGD-peptide-INT fusion protein.
[0156] In another embodiment, the composition is prepared by a) mixing a fusion protein comprising an RGD-peptide fused to a mINT generated in insect larvae cells with a rat MVP generated in insect larvae cells to generate a mixture; b) incubating the mixture for a sufficient period of time to allow packaging of the fusion protein inside of vault complexes.
EXAMPLES
[0157] Below are examples of specific embodiments for carrying out the present invention. The examples are offered for illustrative purposes only, and are not intended to limit the scope of the present invention in any way. Efforts have been made to ensure accuracy with respect to numbers used (e.g., amounts, temperatures, etc.), but some experimental error and deviation should, of course, be allowed for.
[0158] The practice of the present invention will employ, unless otherwise indicated, conventional methods of protein chemistry, biochemistry, recombinant DNA techniques and pharmacology, within the skill of the art. Such techniques are explained fully in the literature. See, e.g., T. E. Creighton, Proteins: Structures and Molecular Properties (W.H. Freeman and Company, 1993); A. L. Lehninger, Biochemistry (Worth Publishers, Inc., current addition); Sambrook, et al., Molecular Cloning: A Laboratory Manual (2nd Edition, 1989); Methods In Enzymology (S. Colowick and N. Kaplan eds., Academic Press, Inc.); Remington's Pharmaceutical Sciences, 18th Edition (Easton, Pa.: Mack Publishing Company, 1990); Carey and Sundberg Advanced Organic Chemistry 3rd Ed. (Plenum Press) Vols A and B(1992).
Example 1
GRGDSP Prevents Early Progression of Type 2 and Type 1 DN
[0159] We investigated the ability of cyclic GRGDSP vs. GRGESP in a pilot study to prevent accumulation of glomerular lesions in early DN in 20 week old diabetic type 2 db/db vs non-diabetic db/m and diabetic type 1 Ins2Akita+ vs. non-diabetic Ins2+/+ mice with GRGESP and GRGESP (400-2400 μg/kg) and observed up to 52% reduction in albuminuria in the type 2 diabetic mice (FIGS. 1-2 ) and ˜70% reduction in albuminuria in the type 1 diabetic mice (FIG. 6 ). The physiologic changes were confirmed by molecular studies which showed significant reduction in glomerular expression extracellular matrix by Periodic Acid Schiff and electron microscopy and DN signaling proteins by Western blot analyses.
Example 2
GRGDSP Causes Regression of Advanced Lesions of Type 2 DN
[0160] We investigated the ability of cyclic GRGDSP vs. GRGESP in a pilot study to reverse established DN and treated 21-week-old diabetic db/db mice with GRGDSP and GRGESP (2400-4800 μg/kg) and observed up to 71% reduction in albuminuria (FIG. 7 ), reduced mesangial expansion and improved creatinine clearance after 4 weeks of i.p. administration (p<0.05, by ANOVA) in a dose-dependent manner. Quantification of Periodic Schiff Stained kidney section revealed a significant reduction in glomerulosclerosis index (p<0.05 by ANOVA). In addition, Western blot analysis of kidney cortical tissues consistently showed, reduced expression of fibronectin, collagen I, collagen IV, transforming growth factor (TGF)-β, which is a well established profibrotic cytokine in DN, and ERK/MAPK as well as reduce Nox4 protein expression (p<0.05 by ANOVA).
Example 3
Design of a Potent D-Peptide and a Functional D-Vault Nanocapsule
[0161] Vaults are self-assembled from 96 copies of the major vault protein (MVP) to provide a dynamic, accessible internal volume (5×107 Å) with a cysteine-rich 162aa sequence (INT-domain) on the C-terminus of the vault poly ADP-ribose polymerase, which interacts with MVP. The vault dimension is 72.5×41 nm. In order to design RGD-containing-vault nanocapsules, cyclic GRGDSP- and GRGESP-control peptides were modified to incorporate a free cysteine residue to allow formation of disulfide bonds between the peptides and one or more free cysteine residues on the INT-domain (22 kDa) of vault MVP. Incorporation of the cyclic GRGDSP- and GRGESP-control peptides into vault nanocapsules was monitored during generation and dialysis-purification steps by detecting free SH groups using Ellman's reagent and a cysteine standard based on molar absorbance at 412 nm. D-peptide was incubated with INT and GL-INT (which is a variant with fluorescent green lantern (GL) protein fused to the INT-domain to facilitate vault visualization in vitro and in vivo) in binding buffer containing glutathione redox pairs ×1 h and dialyzed (MWCO 12-14 kDa).
Example 4
Dose-Dependent Inhibition of Primary Mesangial Cell Adhesion to Fibronectin by CGRGDSP Peptide
[0162] The CGRGDSP peptide was more potent in inhibiting α5β1 integrin receptor binding to FN than the GRGDSP peptide at comparable dose. In particular, CGRGDSP showed a 2.4-fold and 2.8 fold enhanced potency of D- vs. E-control peptide (200 μg/ml and 400 μg/ml, respectively) in inhibiting MC adhesion to fibronectin-coated plates compared to GRGDSP (FIG. 12 ).
Example 5
Vault Expression (MVP) in Primary Mesangial Cells and Renal Tissues
[0163] Naturally occurring vaults (MVP) were found to be present in primary mesangial cells and renal tissues (FIG. 10A ). MVP expression was not regulated by growth factors in vitro or by RGD active and RGE control peptides in vivo (FIG. 10B ). Cells were starved for 24 h and then treated with or without 1 μM angiotensin II and 1 μM insulin for 48 h, and with high glucose (20 mM) for 24 h. Cell lysates were collected and analyzed for MVP protein expression using rabbit polyclonal anti-MVP or for β-actin as internal loading control. No significant changes were observed in MVP expression in untreated cells compared to stimulated cells. Purified MVP was used as positive control. For in vivo tests, mice were administered 2400 ug/kg GRGDSP and GRGESP peptides intraperitoneally, three times/week for 4-weeks. Kidneys were isolated and analyzed for MVP expression and β-actin as internal loading control. Data shows N=2 animals/treatment group, but is representative of N=6. MVP showed no significant changes between the groups.
Example 6
Localization and Appearance of CRGDSP-Vaults
[0164] Active RGD vault nanocapsules were observed by immunofluorescence to be primarily localized to the cell surface of primary mesangial cells (FIG. 15 ). In addition, electron microscopy confirmed that active RGD-vault nanocapsules have the same appearance as naturally occurring vaults (FIG. 16 ).
Example 7
Inhibition of Primary Mesangial Cell Adhesion to Fibronectin by CGRGDSP Peptide-Vault Nanoparticles
[0165] CGRGDSP peptide D-vault and E-vault (control) samples were generated by incubation of peptide-INT with purified vault (96MVP's; ˜100 kDa) and dialyzed (MWCO 50 kDa) until no free SH groups were detected. Adhesion assays demonstrated that D-vault inhibited attachment of MC to fibronectin 1.7-fold compared to untreated MC, p<0.05, a level of inhibition comparable to that observed with GRGDSP. There was no inhibition of adhesion with the empty vault or E-vault controls (FIG. 17 ).
Example 8
Design of Additional Inhibitors by Computational Modeling
[0166] The above results demonstrate that when the RGD inhibitor is inserted, it will attach to the integrin, thereby blocking the fibronectin from adhesion. Preferably, the synthetic analog inhibitors should have higher affinity to the integrin than the RGD loop of fibronectin. Regarding the potential antibody selection, since the six-member amino acid cyc-RGDSPG has been proved to be a successful candidate of inhibitors, it was used as a standard reference structure for the design of potential inhibitors. It was determined that new compounds that are structurally similar to cyc-RGDSPG can also act as efficient inhibitors. For example, two additional RGD peptides (cyc-RGDSPCG and cyc-RGDSPSG) have been confirmed to be efficient inhibitors. These two cyclic peptides were also used as reference structures to construct new inhibitors.
[0167] The investigations began with the predictions of characteristics of cyc-RGDSPG, cyc-RGDSPCG and cyc-RGDSPSG (which are six-member and seven-member amino acids related to the cyclic pattern RGD inhibitors). Various conformers of the above three peptides were studied. The calculations included optimizations of molecular structures, predictions of electrostatic potentials, and computations of charge density distribution.
[0168] As the next step, the five-member amino acid of cyc-RGDSG were studied to check if the amino acid P has any influence on the properties of the RGD fragment of the cyc-RGDSPG. Also, cyc-RGDGPS and cyc-RGDGS, which differ by the positions of G and S from the known inhibitor, were evaluated. Through comparison of the properties of cyc-RGDGPS, cyc-RGDSPG, cyc-RGDGS, and cyc-RGDSG, it was possible to reveal how the differences of the molecular structures of considered compounds influence their properties.
[0169] Based on the results from the previous step, analogous compounds having high activity were designed. Various structures were tested, including the cyclic types derived from the five-member amino acid RGD inhibitors, six-member amino acid RGD inhibitors, seven-member amino acid RGD inhibitors, and linear-type inhibitors which are constructed by 3-7 amino acids, including the RGD fragment.
[0170] Nonempirical—reliable Density Functional Theory at the B3LYP/6-31G(d,p) level is used in this study. Molecular geometries of various components have been fully optimized. So far, six different conformers of the linear RGD chain have been located. The geometrical parameters, stabilities, electronic energies, charge distribution and other properties of these conformers were analyzed and compared.
[0171] According to the experimentally-verified results, one energy minima structure has been located for each cyc-RGDSPG, cyc-RGDSPCG, and cyc-RGDSPSG complex. Also different conformers of these cyclic RGD inhibitors were located on their respective potential energy surfaces. These results were compared with the RGD chain conformers to establish the most favorable conformer structure for the inhibition.
[0172] Combining the experimental results with the data obtained from our calculations we were able to predict the efficiency of the various inhibitors and to determine which structure is the most favorable fragment with regard to integrin binding energy. FIG. 7 shows the optimized structures for the RGD inhibitor at B3LYP/6-31G(d,p). Theoretical level are shown in FIG. 7 , and the highlighted structures (i.e., cyc-RGDSPG, cyc-RGDSPCG, and cyc-RGDSPSG) are those that are experimentally-verified as efficient inhibitors.
[0173] While the invention has been particularly shown and described with reference to a preferred embodiment and various alternate embodiments, it will be understood by persons skilled in the relevant art that various changes in form and details can be made therein without departing from the spirit and scope of the invention.
[0174] All references, issued patents and patent applications cited within the body of the instant specification are hereby incorporated by reference in their entirety, for all purposes.
| TABLE 1 |
|---|
| Sequences |
| SEQ ID NO: 1 |
| mINT DNA sequence |
| TGC ACA CAA CAC TGG CAG GAT GCT GTG CCT TGG ACA GAA CTC CTC AGT |
| CTA CAG ACA GAG GAT GGC TTC TGG AAA CTT ACA CCA GAA CTG GGA CTT |
| ATA TTA AAT CTT AAT ACA AAT GGT TTG CAC AGC TTT CTT AAA CAA AAA |
| GGC ATT CAA TCT CTA GGT GTA AAA GGA AGA GAA TGT CTC CTG GAC CTA |
| ATT GCC ACA ATG CTG GTA CTA CAG TTT ATT CGC ACC AGG TTG GAA AAA |
| GAG GGA ATA GTG TTC AAA TCA CTG ATG AAA ATG GAT GAC CCT TCT ATT |
| TCC AGG AAT ATT CCC TGG GCT TTT GAG GCA ATA AAG CAA GCA AGT GAA |
| TGG GTA AGA AGA ACT GAA GGA CAG TAC CCA TCT ATC TGC CCA CGG CTT |
| GAA CTG GGG AAC GAC TGG GAC TCT GCC ACC AAG CAG TTG CTG GGA CTC |
| CAG CCC ATA AGC ACT GTG TCC CCT CTT CAT AGA GTC CTC CAT TAC AGT |
| CAA GGC TAA |
| SEQ ID NO: 2 |
| mINT protein sequence (residues 1563-1724 of the human |
| VPARP protein sequence) |
| CTQHWQDAVPWTELLSLQTEDGFWKLTPELGLILNLNTNGLHSFLKQKGIQSLGVKGRECLLDLIA |
| TMLVLQFIRTRLEKEGIVFKSLMKMDDPSISRNIPWAFEAIKQASEWVRRTEGQYPSICPRLELGN |
| DWDSATKQLLGLQPISTVSPLHRVLHYSQG |
| SEQ ID NO: 3 |
| VPARP protein sequence (Genbank #AAD47250) |
| Met Val Met Gly Ile Phe Ala Asn Cys Ile Phe Cys Leu Lys Val Lys Tyr Leu |
| Pro Gln Gln Gln Lys Lys Lys Leu Gln Thr Asp Ile Lys Glu Asn Gly Gly Lys |
| Phe Ser Phe Ser Leu Asn Pro Gln Cys Thr His Ile Ile Leu Asp Asn Ala Asp |
| Val Leu Ser Gln Tyr Gln Leu Asn Ser Ile Gln Lys Asn His Val His Ile Ala |
| Asn Pro Asp Phe Ile Trp Lys Ser Ile Arg Glu Lys Arg Leu Leu Asp Val Lys |
| Asn Tyr Asp Pro Tyr Lys Pro Leu Asp Ile Thr Pro Pro Pro Asp Gln Lys Ala |
| Ser Ser Ser Glu Val Lys Thr Glu Gly Leu Cys Pro Asp Ser Ala Thr Glu Glu |
| Glu Asp Thr Val Glu Leu Thr Glu Phe Gly Met Gln Asn Val Glu Ile Pro His |
| Leu Pro Gln Asp Phe Glu Val Ala Lys Tyr Asn Thr Leu Glu Lys Val Gly Met |
| Glu Gly Gly Gln Glu Ala Val Val Val Glu Leu Gln Cys Ser Arg Asp Ser Arg |
| Asp Cys Pro Phe Leu Ile Ser Ser His Phe Leu Leu Asp Asp Gly Met Glu Thr |
| Arg Arg Gln Phe Ala Ile Lys Lys Thr Ser Glu Asp Ala Ser Glu Tyr Phe Glu |
| Asn Tyr Ile Glu Glu Leu Lys Lys Gln Gly Phe Leu Leu Arg Glu His Phe Thr |
| Pro Glu Ala Thr Gln Leu Ala Ser Glu Gln Leu Gln Ala Leu Leu Leu Glu Glu |
| Val Met Asn Ser Ser Thr Leu Ser Gln Glu Val Ser Asp Leu Val Glu Met Ile |
| Trp Ala Glu Ala Leu Gly His Leu Glu His Met Leu Leu Lys Pro Val Asn Arg |
| Ile Ser Leu Asn Asp Val Ser Lys Ala Glu Gly Ile Leu Leu Leu Val Lys Ala |
| Ala Leu Lys Asn Gly Glu Thr Ala Glu Gln Leu Gln Lys Met Met Thr Glu Phe |
| Tyr Arg Leu Ile Pro His Lys Gly Thr Met Pro Lys Glu Val Asn Leu Gly Leu |
| Leu Ala Lys Lys Ala Asp Leu Cys Gln Leu Ile Arg Asp Met Val Asn Val Cys |
| Glu Thr Asn Leu Ser Lys Pro Asn Pro Pro Ser Leu Ala Lys Tyr Arg Ala Leu |
| Arg Cys Lys Ile Glu His Val Glu Gln Asn Thr Glu Glu Phe Leu Arg Val Arg |
| Lys Glu Val Leu Gln Asn His His Ser Lys Ser Pro Val Asp Val Leu Gln Ile |
| Phe Arg Val Gly Arg Val Asn Glu Thr Thr Glu Phe Leu Ser Lys Leu Gly Asn |
| Val Arg Pro Leu Leu His Gly Ser Pro Val Gln Asn Ile Val Gly Ile Leu Cys |
| Arg Gly Leu Leu Leu Pro Lys Val Val Glu Asp Arg Gly Val Gln Arg Thr Asp |
| Val Gly Asn Leu Gly Ser Gly Ile Tyr Phe Ser Asp Ser Leu Ser Thr Ser Ile |
| Lys Tyr Ser His Pro Gly Glu Thr Asp Gly Thr Arg Leu Leu Leu Ile Cys Asp |
| Val Ala Leu Gly Lys Cys Met Asp Leu His Glu Lys Asp Phe Pro Leu Thr Glu |
| Ala Pro Pro Gly Tyr Asp Ser Val His Gly Val Ser Gln Thr Ala Ser Val Thr |
| Thr Asp Phe Glu Asp Asp Glu Phe Val Val Tyr Lys Thr Asn Gln Val Lys Met |
| Lys Tyr Ile Ile Lys Phe Ser Met Pro Gly Asp Gln Ile Lys Asp Phe His Pro |
| Ser Asp His Thr Glu Leu Glu Glu Tyr Arg Pro Glu Phe Ser Asn Phe Ser Lys |
| Val Glu Asp Tyr Gln Leu Pro Asp Ala Lys Thr Ser Ser Ser Thr Lys Ala Gly |
| Leu Gln Asp Ala Ser Gly Asn Leu Val Pro Leu Glu Asp Val His Ile Lys Gly |
| Arg Ile Ile Asp Thr Val Ala Gln Val Ile Val Phe Gln Thr Tyr Thr Asn Lys |
| Ser His Val Pro Ile Glu Ala Lys Tyr Ile Phe Pro Leu Asp Asp Lys Ala Ala |
| Val Cys Gly Phe Glu Ala Phe Ile Asn Gly Lys His Ile Val Gly Glu Ile Lys |
| Glu Lys Glu Glu Ala Gln Gln Glu Tyr Leu Glu Ala Val Thr Gln Gly His Gly |
| Ala Tyr Leu Met Ser Gln Asp Ala Pro Asp Val Phe Thr Val Ser Val Gly Asn |
| Leu Pro Pro Lys Ala Lys Val Leu Ile Lys Ile Thr Tyr Ile Thr Glu Leu Ser |
| Ile Leu Gly Thr Val Gly Val Phe Phe Met Pro Ala Thr Val Ala Pro Trp Gln |
| Gln Asp Lys Ala Leu Asn Glu Asn Leu Gln Asp Thr Val Glu Lys Ile Cys Ile |
| Lys Glu Ile Gly Thr Lys Gln Ser Phe Ser Leu Thr Met Ser Ile Glu Met Pro |
| Tyr Val Ile Glu Phe Ile Phe Ser Asp Thr His Glu Leu Lys Gln Lys Arg Thr |
| Asp Cys Lys Ala Val Ile Ser Thr Met Glu Gly Ser Ser Leu Asp Ser Ser Gly |
| Phe Ser Leu His Ile Gly Leu Ser Ala Ala Tyr Leu Pro Arg Met Trp Val Glu |
| Lys His Pro Glu Lys Glu Ser Glu Ala Cys Met Leu Val Phe Gln Pro Asp Leu |
| Asp Val Asp Leu Pro Asp Leu Ala Ser Glu Ser Glu Val Ile Ile Cys Leu Asp |
| Cys Ser Ser Ser Met Glu Gly Val Thr Phe Leu Gln Ala Lys Gln Ile Thr Leu |
| His Ala Leu Ser Leu Val Gly Glu Lys Gln Lys Val Asn Ile Ile Gln Phe Gly |
| Thr Gly Tyr Lys Glu Leu Phe Ser Tyr Pro Lys His Ile Thr Ser Asn Thr Thr |
| Ala Ala Glu Phe Ile Met Ser Ala Thr Pro Thr Met Gly Asn Thr Asp Phe Trp |
| Lys Thr Leu Arg Tyr Leu Ser Leu Leu Tyr Pro Ala Arg Gly Ser Arg Asn Ile |
| Leu Leu Val Ser Asp Gly His Leu Gln Asp Glu Ser Leu Thr Leu Gln Leu Val |
| Lys Arg Ser Arg Pro His Thr Arg Leu Phe Ala Cys Gly Ile Gly Ser Thr Ala |
| Asn Arg His Val Leu Arg Ile Leu Ser Gln Cys Gly Ala Gly Val Phe Glu Tyr |
| Phe Asn Ala Lys Ser Lys His Ser Trp Arg Lys Gln Ile Glu Asp Gln Met Thr |
| Arg Leu Cys Ser Pro Ser Cys His Ser Val Ser Val Lys Trp Gln Gln Leu Asn |
| Pro Asp Ala Pro Glu Ala Leu Gln Ala Pro Ala Gln Val Pro Ser Leu Phe Arg |
| Asn Asp Arg Leu Leu Val Tyr Gly Phe Ile Pro His Cys Thr Gln Ala Thr Leu |
| Cys Ala Leu Ile Gln Glu Lys Glu Phe Cys Thr Met Val Ser Thr Thr Glu Leu |
| Gln Lys Thr Thr Gly Thr Met Ile His Lys Leu Ala Ala Arg Ala Leu Ile Arg |
| Asp Tyr Glu Asp Gly Ile Leu His Glu Asn Glu Thr Ser His Glu Met Lys Lys |
| Gln Thr Leu Lys Ser Leu Ile Ile Lys Leu Ser Lys Glu Asn Ser Leu Ile Thr |
| Gln Phe Thr Ser Phe Val Ala Val Glu Lys Arg Asp Glu Asn Glu Ser Pro Phe |
| Pro Asp Ile Pro Lys Val Ser Glu Leu Ile Ala Lys Glu Asp Val Asp Phe Leu |
| Pro Tyr Met Ser Trp Gln Gly Glu Pro Gln Glu Ala Val Arg Asn Gln Ser Leu |
| Leu Ala Ser Ser Glu Trp Pro Glu Leu Arg Leu Ser Lys Arg Lys His Arg Lys |
| Ile Pro Phe Ser Lys Arg Lys Met Glu Leu Ser Gln Pro Glu Val Ser Glu Asp |
| Phe Glu Glu Asp Gly Leu Gly Val Leu Pro Ala Phe Thr Ser Asn Leu Glu Arg |
| Gly Gly Val Glu Lys Leu Leu Asp Leu Ser Trp Thr Glu Ser Cys Lys Pro Thr |
| Ala Thr Glu Pro Leu Phe Lys Lys Val Ser Pro Trp Glu Thr Ser Thr Ser Ser |
| Phe Phe Pro Ile Leu Ala Pro Ala Val Gly Ser Tyr Leu Thr Pro Thr Thr Arg |
| Ala His Ser Pro Ala Ser Leu Ser Phe Ala Ser Tyr Arg Gln Val Ala Ser Phe |
| Gly Ser Ala Ala Pro Pro Arg Gln Phe Asp Ala Ser Gln Phe Ser Gln Gly Pro |
| Val Pro Gly Thr Cys Ala Asp Trp Ile Pro Gln Ser Ala Ser Cys Pro Thr Gly |
| Pro Pro Gln Asn Pro Pro Ser Ala Pro Tyr Cys Gly Ile Val Phe Ser Gly Ser |
| Ser Leu Ser Ser Ala Gln Ser Ala Pro Leu Gln His Pro Gly Gly Phe Thr Thr |
| Arg Pro Ser Ala Gly Thr Phe Pro Glu Leu Asp Ser Pro Gln Leu His Phe Ser |
| Leu Pro Thr Asp Pro Asp Pro Ile Arg Gly Phe Gly Ser Tyr His Pro Ser Ala |
| Tyr Ser Pro Phe His Phe Gln Pro Ser Ala Ala Ser Leu Thr Ala Asn Leu Arg |
| Leu Pro Met Ala Ser Ala Leu Pro Glu Ala Leu Cys Ser Gln Ser Arg Thr Thr |
| Pro Val Asp Leu Cys Leu Leu Glu Glu Ser Val Gly Ser Leu Glu Gly Ser Arg |
| Cys Pro Val Phe Ala Phe Gln Ser Ser Asp Thr Glu Ser Asp Glu Leu Ser Glu |
| Val Leu Gln Asp Ser Cys Phe Leu Gln Ile Lys Cys Asp Thr Lys Asp Asp Ser |
| Ile Pro Cys Phe Leu Glu Leu Lys Glu Glu Asp Glu Ile Val Cys Thr Gln His |
| Trp Gln Asp Ala Val Pro Trp Thr Glu Leu Leu Ser Leu Gln Thr Glu Asp Gly |
| Phe Trp Lys Leu Thr Pro Glu Leu Gly Leu Ile Leu Asn Leu Asn Thr Asn Gly |
| Leu His Ser Phe Leu Lys Gln Lys Gly Ile Gln Ser Leu Gly Val Lys Gly Arg |
| Glu Cys Leu Leu Asp Leu Ile Ala Thr Met Leu Val Leu Gln Phe Ile Arg Thr |
| Arg Leu Glu Lys Glu Gly Ile Val Phe Lys Ser Leu Met Lys Met Asp Asp Pro |
| Ser Ile Ser Arg Asn Ile Pro Trp Ala Phe Glu Ala Ile Lys Gln Ala Ser Glu |
| Trp Val Arg Arg Thr Glu Gly Gln Tyr Pro Ser Ile Cys Pro Arg Leu Glu Leu |
| Gly Asn Asp Trp Asp Ser Ala Thr Lys Gln Leu Leu Gly Leu Gln Pro Ile Ser |
| Thr Val Ser Pro Leu His Arg Val Leu His Tyr Ser Gln Gly |
| SER ID NO: 5 |
| VPARP cDNA, Genbank #AF158255 |
| atggtgatgg gaatctttgc aaattgtatc ttctgtttga aagtgaagta cttacctcag |
| cagcagaaga aaaagctaca aactgacatt aaggaaaatg gcggaaagtt ttccttttcg |
| ttaaatcctc agtgcacaca tataatctta gataatgctg atgttctgag tcagtaccaa |
| ctgaattcta tccaaaagaa ccacgttcat attgcaaacc cagattttat atggaaatct |
| atcagagaaa agagactctt ggatgtaaag aattatgatc cttataagcc cctggacatc |
| acaccacctc ctgatcagaa ggcgagcagt tctgaagtga aaacagaagg tctatgcccg |
| gacagtgcca cagaggagga agacactgtg gaactcactg agtttggtat gcagaatgtt |
| gaaattcctc atcttcctca agattttgaa gttgcaaaat ataacacctt ggagaaagtg |
| ggaatggagg gaggccagga agctgtggtg gtggagcttc agtgttcgcg ggactccagg |
| gactgtcctt tcctgatatc ctcacacttc ctcctggatg atggcatgga gactagaaga |
| cagtttgcta taaagaaaac ctctgaagat gcaagtgaat actttgaaaa ttacattgaa |
| gaactgaaga aacaaggatt tctactaaga gaacatttca cacctgaagc aacccaatta |
| gcatctgaac aattgcaagc attgcttttg gaggaagtca tgaattcaag cactctgagc |
| caagaggtga gcgatttagt agagatgatt tgggcagagg ccctgggcca cctggaacac |
| atgcttctca agccagtgaa caggattagc ctcaacgatg tgagcaaggc agaggggatt |
| ctccttctag taaaggcagc actgaaaaat ggagaaacag cagagcaatt gcaaaagatg |
| atgacagagt tttacagact gatacctcac aaaggcacaa tgcccaaaga agtgaacctg |
| ggactattgg ctaagaaagc agacctctgc cagctaataa gagacatggt taatgtctgt |
| gaaactaatt tgtccaaacc caacccacca tccctggcca aataccgagc tttgaggtgc |
| aaaattgagc atgttgaaca gaatactgaa gaatttctca gggttagaaa agaggttttg |
| cagaatcatc acagtaagag cccagtggat gtcttgcaga tatttagagt tggcagagtg |
| aatgaaacca cagagttttt gagcaaactt ggtaatgtga ggcccttgtt gcatggttct |
| cctgtacaaa acatcgtggg aatcttgtgt cgagggttgc ttttacccaa agtagtggaa |
| gatcgtggtg tgcaaagaac agacgtcgga aaccttggaa gtgggattta tttcagtgat |
| tcgctcagta caagtatcaa gtactcacac ccgggagaga cagatggcac cagactcctg |
| ctcatttgtg acgtagccct cggaaagtgt atggacttac atgagaagga ctttccctta |
| actgaagcac caccaggcta cgacagtgtg catggagttt cacaaacagc ctctgtcacc |
| acagactttg aggatgatga atttgttgtc tataaaacca atcaggttaa aatgaaatat |
| attattaaat tttccatgcc tggagatcag ataaaggact ttcatcctag tgatcatact |
| gaattagagg aatacagacc tgagttttca aatttttcaa aggttgaaga ttaccagtta |
| ccagatgcca aaacttccag cagcaccaag gccggcctcc aggatgcctc tgggaacttg |
| gttcctctgg aggatgtcca catcaaaggg agaatcatag acactgtagc ccaggtcatt |
| gtttttcaga catacacaaa taaaagtcac gtgcccattg aggcaaaata tatctttcct |
| ttggatgaca aggccgctgt gtgtggcttc gaagccttca tcaatgggaa gcacatagtt |
| ggagagatta aagagaagga agaagcccag caagagtacc tagaagccgt gacccagggc |
| catggcgctt acctgatgag tcaggatgct ccggacgttt ttactgtaag tgttggaaac |
| ttacccccta aggctaaggt tcttataaaa attacctaca tcacagaact cagcatcctg |
| ggcactgttg gtgtcttttt catgcccgcc accgtagcac cctggcaaca ggacaaggct |
| ttgaatgaaa accttcagga tacagtagag aagatttgta taaaagaaat aggaacaaag |
| caaagcttct ctttgactat gtctattgag atgccgtatg tgattgaatt cattttcagt |
| gatacacatg aactgaaaca aaagcgcaca gactgcaaag ctgtcattag caccatggaa |
| ggcagctcct tagacagcag tggattttct ctccacatcg gtttgtctgc tgcctatctc |
| ccaagaatgt gggttgaaaa acatccagaa aaagaaagcg aggcttgcat gcttgtcttt |
| caacccgatc tcgatgtcga cctccctgac ctagccagtg agagcgaagt gattatttgt |
| cttgactgct ccagttccat ggagggtgtg acattcttgc aagccaagca aatcaccttg |
| catgcgctgt ccttggtggg tgagaagcag aaagtaaata ttatccagtt cggcacaggt |
| tacaaggagc tattttcgta tcctaagcat atcacaagca ataccacggc agcagagttc |
| atcatgtctg ccacacctac catggggaac acagacttct ggaaaacact ccgatatctt |
| agcttattgt accctgctcg agggtcacgg aacatcctcc tggtgtctga tgggcacctc |
| caggatgaga gcctgacatt acagctcgtg aagaggagcc gcccgcacac caggttattc |
| gcctgcggta tcggttctac agcaaatcgt cacgtcttaa ggattttgtc ccagtgtggt |
| gccggagtat ttgaatattt taatgcaaaa tccaagcata gttggagaaa acagatagaa |
| gaccaaatga ccaggctatg ttctccgagt tgccactctg tctccgtcaa atggcagcaa |
| ctcaatccag atgcgcccga ggccctgcag gccccagccc aggtgccatc cttgtttcgc |
| aatgatcgac tccttgtcta tggattcatt cctcactgca cacaagcaac tctgtgtgca |
| ctaattcaag agaaagaatt ttgtacaatg gtgtcgacta ctgagcttca gaagacaact |
| ggaactatga tccacaagct ggcagcccga gctctaatca gagattatga agatggcatt |
| cttcacgaaa atgaaaccag tcatgagatg aaaaaacaaa ccttgaaatc tctgattatt |
| aaactcagta aagaaaactc tctcataaca caatttacaa gctttgtggc agttgagaaa |
| agggatgaga atgagtcgcc ttttcctgat attccaaaag tttctgaact tattgccaaa |
| gaagatgtag acttcctgcc ctacatgagc tggcaggggg agccccaaga agccgtcagg |
| aaccagtctc ttttagcatc ctctgagtgg ccagaattac gtttatccaa acgaaaacat |
| aggaaaattc cattttccaa aagaaaaatg gaattatctc agccagaagt ttctgaagat |
| tttgaagagg atggcttagg tgtactacca gctttcacat caaatttgga acgtggaggt |
| gtggaaaagc tattggattt aagttggaca gagtcatgta aaccaacagc aactgaacca |
| ctatttaaga aagtcagtcc atgggaaaca tctacttcta gcttttttcc tattttggct |
| ccggccgttg gttcctatct taccccgact acccgcgctc acagtcctgc ttccttgtct |
| tttgcctcat atcgtcaggt agctagtttc ggttcagctg ctcctcccag acagtttgat |
| gcatctcaat tcagccaagg ccctgtgcct ggcacttgtg ctgactggat cccacagtcg |
| gcgtcttgtc ccacaggacc tccccagaac ccaccttctg caccctattg tggcattgtt |
| ttttcaggga gctcattaag ctctgcacag tctgctccac tgcaacatcc tggaggcttt |
| actaccaggc cttctgctgg caccttccct gagctggatt ctccccagct tcatttctct |
| cttcctacag accctgatcc catcagaggt tttgggtctt atcatccctc tgcttactct |
| ccttttcatt ttcaaccttc cgcagcctct ttgactgcca accttaggct gccaatggcc |
| tctgctttac ctgaggctct ttgcagtcag tcccggacta ccccagtaga tctctgtctt |
| ctagaagaat cagtaggcag tctcgaagga agtcgatgtc ctgtctttgc ttttcaaagt |
| tctgacacag aaagtgatga gctatcagaa gtacttcaag acagctgctt tttacaaata |
| aagtgtgata caaaagatga cagtatcccg tgctttctgg aattaaaaga agaggatgaa |
| atagtgtgca cacaacactg gcaggatgct gtgccttgga cagaactcct cagtctacag |
| acagaggatg gcttctggaa acttacacca gaactgggac ttatattaaa tcttaataca |
| aatggtttgc acagctttct taaacaaaaa ggcattcaat ctctaggtgt aaaaggaaga |
| gaatgtctcc tggacctaat tgccacaatg ctggtactac agtttattcg caccaggttg |
| gaaaaagagg gaatagtgtt caaatcactg atgaaaatgg atgacccttc tatttccagg |
| aatattccct gggcttttga ggcaataaag caagcaagtg aatgggtaag aagaactgaa |
| ggacagtacc catctatctg cccacggctt gaactgggga acgactggga ctctgccacc |
| aagcagttgc tgggactcca gcccataagc actgtgtccc ctcttcatag agtcctccat |
| tacagtcaag gctaa |
| SEQ ID NO: 6 |
| MVP (Genbank #CAA56256) |
| Met Ala Thr Glu Glu Phe Ile Ile Arg Ile Pro Pro Tyr His Tyr Ile His Val |
| Leu Asp Gln Asn Ser Asn Val Ser Arg Val Glu Val Gly Pro Lys Thr Tyr Ile |
| Arg Gln Asp Asn Glu Arg Val Leu Phe Ala Pro Met Arg Met Val Thr Val Pro |
| Pro Arg His Tyr Cys Thr Val Ala Asn Pro Val Ser Arg Asp Ala Gln Gly Leu |
| Val Leu Phe Asp Val Thr Gly Gln Val Arg Leu Arg His Ala Asp Leu Glu Ile |
| Arg Leu Ala Gln Asp Pro Phe Pro Leu Tyr Pro Gly Glu Val Leu Glu Lys Asp |
| Ile Thr Pro Leu Gln Val Val Leu Pro Asn Thr Ala Leu His Leu Lys Ala Leu |
| Leu Asp Phe Glu Asp Lys Asp Gly Asp Lys Val Val Ala Gly Asp Glu Trp Leu |
| Phe Glu Gly Pro Gly Thr Tyr Ile Pro Arg Lys Glu Val Glu Val Val Glu Ile |
| Ile Gln Ala Thr Ile Ile Arg Gln Asn Gln Ala Leu Arg Leu Arg Ala Arg Lys |
| Glu Cys Trp Asp Arg Asp Gly Lys Glu Arg Val Thr Gly Glu Glu Trp Leu Val |
| Thr Thr Val Gly Ala Tyr Leu Pro Ala Val Phe Glu Glu Val Leu Asp Leu Val |
| Asp Ala Val Ile Leu Thr Glu Lys Thr Ala Leu His Leu Arg Ala Arg Arg Asn |
| Phe Arg Asp Phe Arg Gly Val Ser Arg Arg Thr Gly Glu Glu Trp Leu Val Thr |
| Val Gln Asp Thr Glu Ala His Val Pro Asp Val His Glu Glu Val Leu Gly Val |
| Val Pro Ile Thr Thr Leu Gly Pro His Asn Tyr Cys Val Ile Leu Asp Pro Val |
| Gly Pro Asp Gly Lys Asn Gln Leu Gly Gln Lys Arg Val Val Lys Gly Glu Lys |
| Ser Phe Phe Leu Gln Pro Gly Glu Gln Leu Glu Gln Gly Ile Gln Asp Val Tyr |
| Val Leu Ser Glu Gln Gln Gly Leu Leu Leu Arg Ala Leu Gln Pro Leu Glu Glu |
| Gly Glu Asp Glu Glu Lys Val Ser His Gln Ala Gly Asp His Trp Leu Ile Arg |
| Gly Pro Leu Glu Tyr Val Pro Ser Ala Lys Val Glu Val Val Glu Glu Arg Gln |
| Ala Ile Pro Leu Asp Glu Asn Glu Gly Ile Tyr Val Gln Asp Val Lys Thr Gly |
| Lys Val Arg Ala Val Ile Gly Ser Thr Tyr Met Leu Thr Gln Asp Glu Val Leu |
| Trp Glu Lys Glu Leu Pro Pro Gly Val Glu Glu Leu Leu Asn Lys Gly Gln Asp |
| Pro Leu Ala Asp Arg Gly Glu Lys Asp Thr Ala Lys Ser Leu Gln Pro Leu Ala |
| Pro Arg Asn Lys Thr Arg Val Val Ser Tyr Arg Val Pro His Asn Ala Ala Val |
| Gln Val Tyr Asp Tyr Arg Glu Lys Arg Ala Arg Val Val Phe Gly Pro Glu Leu |
| Val Ser Leu Gly Pro Glu Glu Gln Phe Thr Val Leu Ser Leu Ser Ala Gly Arg |
| Pro Lys Arg Pro His Ala Arg Arg Ala Leu Cys Leu Leu Leu Gly Pro Asp Phe |
| Phe Thr Asp Val Ile Thr Ile Glu Thr Ala Asp His Ala Arg Leu Gln Leu Gln |
| Leu Ala Tyr Asn Trp His Phe Glu Val Asn Asp Arg Lys Asp Pro Gln Glu Thr |
| Ala Lys Leu Phe Ser Val Pro Asp Phe Val Gly Asp Ala Cys Lys Ala Ile Ala |
| Ser Arg Val Arg Gly Ala Val Ala Ser Val Thr Phe Asp Asp Phe His Lys Asn |
| Ser Ala Arg Ile Ile Arg Thr Ala Val Phe Gly Phe Glu Thr Ser Glu Ala Lys |
| Gly Pro Asp Gly Met Ala Leu Pro Arg Pro Arg Asp Gln Ala Val Phe Pro Gln |
| Asn Gly Leu Val Val Ser Ser Val Asp Val Gln Ser Val Glu Pro Val Asp Gln |
| Arg Thr Arg Asp Ala Leu Gln Arg Ser Val Gln Leu Ala Ile Glu Ile Thr Thr |
| Asn Ser Gln Glu Ala Ala Ala Lys His Glu Ala Gln Arg Leu Glu Gln Glu Ala |
| Arg Gly Arg Leu Glu Arg Gln Lys Ile Leu Asp Gln Ser Glu Ala Glu Lys Ala |
| Arg Lys Glu Leu Leu Glu Leu Glu Ala Leu Ser Met Ala Val Glu Ser Thr Gly |
| Thr Ala Lys Ala Glu Ala Glu Ser Arg Ala Glu Ala Ala Arg Ile Glu Gly Glu |
| Gly Ser Val Leu Gln Ala Lys Leu Lys Ala Gln Ala Leu Ala Ile Glu Thr Glu |
| Ala Glu Leu Gln Arg Val Gln Lys Val Arg Glu Leu Glu Leu Val Tyr Ala Arg |
| Ala Gln Leu Glu Leu Glu Val Ser Lys Ala Gln Gln Leu Ala Glu Val Glu Val |
| Lys Lys Phe Lys Gln Met Thr Glu Ala Ile Gly Pro Ser Thr Ile Arg Asp Leu |
| Ala Val Ala Gly Pro Glu Met Gln Val Lys Leu Leu Gln Ser Leu Gly Leu Lys |
| Ser Thr Leu Ile Thr Asp Gly Ser Thr Pro Ile Asn Leu Phe Asn Thr Ala Phe |
| Gly Leu Leu Gly Met Gly Pro Glu Gly Gln Pro Leu Gly Arg Arg Val Ala Ser |
| Gly Pro Ser Pro Gly Glu Gly Ile Ser Pro Gln Ser Ala Gln Ala Pro Gln Ala |
| Pro Gly Asp Asn His Val Val Pro Val Leu Arg |
| SEQ ID NO: 7 |
| MVP cDNA, Genbank #X7982 |
| atggcaactg aagagttcat catccgcatc cccccatacc actatatcca tgtgctggac |
| cagaacagca acgtgtcccg tgtggaggtc gggccaaaga cctacatccg gcaggacaat |
| gagagggtac tgtttgcccc catgcgcatg gtgaccgtcc ccccacgtca ctactgcaca |
| gtggccaacc ctgtgtctcg ggacgcccag ggcttggtgc tgtttgatgt cacagggcaa |
| gttcggcttc gccacgctga cctcgagatc cggctggccc aggacccctt ccccctgtac |
| ccaggggagg tgctggaaaa ggacaccaca cccctgcagg tggttctgcc caacactgcc |
| ctccatctaa aggcgctgct tgattttgag gataaagatg gagacaaggt ggtggcagga |
| gatgagtggc ttttcgaggg acctggcacg tacatccccc ggaaggaagt ggaggtcgtg |
| gagatcattc aggccaccat catcaggcag aaccaggctc tgcggctcag ggcccgcaag |
| gagtgctggg accgggacgg caaggagagg gtgacagggg aagaatggct ggtcaccaca |
| gtaggggcgt acctcccagc ggtgtttgag gaggttctgg atttggtgga cgccgtcatc |
| cttacggaaa agacagccct gcacctccgg gctcggcgga acttccggga cttcagggga |
| gtgtcccgcc gcactgggga ggagtggctg gtaacagtgc aggacacaga ggcccacgtg |
| ccagatgtcc acgaggaggt gctgggggtt gtgcccatca ccaccctggg cccccacaac |
| tactgcgtga ttcccgaccc tgtcggaccg gacggcaaga accagccggg gcagaagcgc |
| gtggtcaagg gagagaagtc ttttttcctc cagccaggag agcagctgga acaaggcatc |
| caggatgtgt atgtgctgtc ggagcagcag gggctgctgc tgagggccct gcagcccctg |
| gaggaggggg aggatgagga gaaggtctca caccaggctg gggaccactg gctcatccgc |
| ggacccctgg agtatgtgcc atctgccaaa gtggaggtgg tggaggagcg ccaggccatc |
| cctctagacg agaacgaggg catctatgtg caggatgtca agaccggaaa ggtgcgcgct |
| gtgattggaa gcacctacat gctgacccag gacgaagtcc tgtgggagaa agagctgcct |
| cccggggtgg aggagctgct gaacaagggg caggaccctc tggcagacag gggtgagaag |
| gacacagcta agagcctcca gcccctggcg ccccggaaca agacccgtgt ggtcagctac |
| cgcgtgcccc acaacgctgc ggtgcaggtg tacgactacc gagagaagcg agcccgcgtg |
| gtcttcgggc ctgagctggt gtcgctgggt cctgaggagc agttcacagt gttgtccctc |
| tcagctgggc ggcccaagcg tccccatgcc cgccgtgcgc tctgcctgct gctggggcct |
| gacttcttca cagacgtcat caccatcgaa acggcggatc atgccaggct gcaactgcag |
| ctggcctaca actggcactt tgaggtgaat gaccggaagg acccccaaga gacggccaag |
| ctcttttcag tgccagactt tgtaggtgat gcctgcaaag ccatcgcatc ccgggtgcgg |
| ggggccgtgg cctctgtcac tttcgatgac ttccataaga actcagcccg catcattcgc |
| actgctgtct ttggctttga gacctcggaa gcgaagggcc ccgatggcat ggccctgccc |
| aggccccggg accaggctgt cttcccccaa aacgggctgg tggtcagcag tgtggacgtg |
| cagtcagtgg agcctgtgga tcagaggacc cgggacgccc tgcaacgcag cgtccagctg |
| gccatcgaga tcaccaccaa cccccaggaa gcggcggcca agcatgaggc tcagagactg |
| gagcaggaag cccgcggccg gcttgagcgg cagaagaccc tggaccagtc agaagccgag |
| aaagctcgca aggaactctt ggagccggag gctctgagca tggccgtgga gagcaccggg |
| actgccaagg cggaggccga gtcccgtgcg gaggcagccc ggattgaggg agaagggtcc |
| gtgctgcagg ccaagctaaa agcacaggcc ttggccattg aaacggaggc tgagctccag |
| agggtccaga aggcccgaga gctggaactg gtctatgccc gggcccagct ggagctggag |
| gtgagcaagg ctcagcagct ggctgaggtg gaggtgaaga agttcaagca gatgacagag |
| gccataggcc ccagcaccat cagggacctt gctgtggctg ggcccgagat gcaggtaaaa |
| ctgctccagt ccctgggcct gaaatcaacc ctcatcaccg atggctccac tcccatcaac |
| ctcttcaaca cagcctttgg gctgctgggg atggggcccg agggtcagcc cctgggcaga |
| agggtggcca gtgggcccag ccctggggag gggatatccc cccagtctgc tcaggcccct |
| caagctcctg gagacaacca cgtggtgcct gtactgcgct aa |
| SEQ ID NO: 8 |
| CP Peptide |
| Met Ala Gly Cys Gly Cys Pro Cys Gly Cys Gly Ala |
| SEQ ID NO: 9 |
| CP-MVP |
| Met Ala Gly Cys Gly Cys Pro Cys Gly Cys Gly Ala Met Ala Thr Glu Glu Phe |
| Ile Ile Arg Ile Pro Pro Tyr His Tyr Ile His Val Leu Asp Gln Asn Ser Asn |
| Val Ser Arg Val Glu Val Gly Pro Lys Thr Tyr Ile Arg Gln Asp Asn Glu Arg |
| Val Leu Phe Ala Pro Met Arg Met Val Thr Val Pro Pro Arg His Tyr Cys Thr |
| Val Ala Asn Pro Val Ser Arg Asp Ala Gln Gly Leu Val Leu Phe Asp Val Thr |
| Gly Gln Val Arg Leu Arg His Ala Asp Leu Glu Ile Arg Leu Ala Gln Asp Pro |
| Phe Pro Leu Tyr Pro Gly Glu Val Leu Glu Lys Asp Ile Thr Pro Leu Gln Val |
| Val Leu Pro Asn Thr Ala Leu His Leu Lys Ala Leu Leu Asp Phe Glu Asp Lys |
| Asp Gly Asp Lys Val Val Ala Gly Asp Glu Trp Leu Phe Glu Gly Pro Gly Thr |
| Tyr Ile Pro Arg Lys Glu Val Glu Val Val Glu Ile Ile Gln Ala Thr Ile Ile |
| Arg Gln Asn Gln Ala Leu Arg Leu Arg Ala Arg Lys Glu Cys Trp Asp Arg Asp |
| Gly Lys Glu Arg Val Thr Gly Glu Glu Trp Leu Val Thr Thr Val Gly Ala Tyr |
| Leu Pro Ala Val Phe Glu Glu Val Leu Asp Leu Val Asp Ala Val Ile Leu Thr |
| Glu Lys Thr Ala Leu His Leu Arg Ala Arg Arg Asn Phe Arg Asp Phe Arg Gly |
| Val Ser Arg Arg Thr Gly Glu Glu Trp Leu Val Thr Val Gln Asp Thr Glu Ala |
| His Val Pro Asp Val His Glu Glu Val Leu Gly Val Val Pro Ile Thr Thr Leu |
| Gly Pro His Asn Tyr Cys Val Ile Leu Asp Pro Val Gly Pro Asp Gly Lys Asn |
| Gln Leu Gly Gln Lys Arg Val Val Lys Gly Glu Lys Ser Phe Phe Leu Gln Pro |
| Gly Glu Gln Leu Glu Gln Gly Ile Gln Asp Val Tyr Val Leu Ser Glu Gln Gln |
| Gly Leu Leu Leu Arg Ala Leu Gln Pro Leu Glu Glu Gly Glu Asp Glu Glu Lys |
| Val Ser His Gln Ala Gly Asp His Trp Leu Ile Arg Gly Pro Leu Glu Tyr Val |
| Pro Ser Ala Lys Val Glu Val Val Glu Glu Arg Gln Ala Ile Pro Leu Asp Glu |
| Asn Glu Gly Ile Tyr Val Gln Asp Val Lys Thr Gly Lys Val Arg Ala Val Ile |
| Gly Ser Thr Tyr Met Leu Thr Gln Asp Glu Val Leu Trp Glu Lys Glu Leu Pro |
| Pro Gly Val Glu Glu Leu Leu Asn Lys Gly Gln Asp Pro Leu Ala Asp Arg Gly |
| Glu Lys Asp Thr Ala Lys Ser Leu Gln Pro Leu Ala Pro Arg Asn Lys Thr Arg |
| Val Val Ser Tyr Arg Val Pro His Asn Ala Ala Val Gln Val Tyr Asp Tyr Arg |
| Glu Lys Arg Ala Arg Val Val Phe Gly Pro Glu Leu Val Ser Leu Gly Pro Glu |
| Glu Gln Phe Thr Val Leu Ser Leu Ser Ala Gly Arg Pro Lys Arg Pro His Ala |
| Arg Arg Ala Leu Cys Leu Leu Leu Gly Pro Asp Phe Phe Thr Asp Val Ile Thr |
| Ile Glu Thr Ala Asp His Ala Arg Leu Gln Leu Gln Leu Ala Tyr Asn Trp His |
| Phe Glu Val Asn Asp Arg Lys Asp Pro Gln Glu Thr Ala Lys Leu Phe Ser Val |
| Pro Asp Phe Val Gly Asp Ala Cys Lys Ala Ile Ala Ser Arg Val Arg Gly Ala |
| Val Ala Ser Val Thr Phe Asp Asp Phe His Lys Asn Ser Ala Arg Ile Ile Arg |
| Thr Ala Val Phe Gly Phe Glu Thr Ser Glu Ala Lys Gly Pro Asp Gly Met Ala |
| Leu Pro Arg Pro Arg Asp Gln Ala Val Phe Pro Gln Asn Gly Leu Val Val Ser |
| Ser Val Asp Val Gln Ser Val Glu Pro Val Asp Gln Arg Thr Arg Asp Ala Leu |
| Gln Arg Ser Val Gln Leu Ala Ile Glu Ile Thr Thr Asn Ser Gln Glu Ala Ala |
| Ala Lys His Glu Ala Gln Arg Leu Glu Gln Glu Ala Arg Gly Arg Leu Glu Arg |
| Gln Lys Ile Leu Asp Gln Ser Glu Ala Glu Lys Ala Arg Lys Glu Leu Leu Glu |
| Leu Glu Ala Leu Ser Met Ala Val Glu Ser Thr Gly Thr Ala Lys Ala Glu Ala |
| Glu Ser Arg Ala Glu Ala Ala Arg Ile Glu Gly Glu Gly Ser Val Leu Gln Ala |
| Lys Leu Lys Ala Gln Ala Leu Ala Ile Glu Thr Glu Ala Glu Leu Gln Arg Val |
| Gln Lys Val Arg Glu Leu Glu Leu Val Tyr Ala Arg Ala Gln Leu Glu Leu Glu |
| Val Ser Lys Ala Gln Gln Leu Ala Glu Val Glu Val Lys Lys Phe Lys Gln Met |
| Thr Glu Ala Ile Gly Pro Ser Thr Ile Arg Asp Leu Ala Val Ala Gly Pro Glu |
| Met Gln Val Lys Leu Leu Gln Ser Leu Gly Leu Lys Ser Thr Leu Ile Thr Asp |
| Gly Ser Thr Pro Ile Asn Leu Phe Asn Thr Ala Phe Gly Leu Leu Gly Met Gly |
| Pro Glu Gly Gln Pro Leu Gly Arg Arg Val Ala Ser Gly Pro Ser Pro Gly Glu |
| Gly Ile Ser Pro Gln Ser Ala Gln Ala Pro Gln Ala Pro Gly Asp Asn His Val |
| Val Pro Val Leu Arg |
| SEQ ID NO: 10 |
| CP-MVP cDNA |
| atggcaggct gcggttgtcc atgcggttgt ggcgccatgg caactgaaga gttcatcatc |
| cgcatccccc cataccacta tatccatgtg ctggaccaga acagcaacgt gtcccgtgtg |
| gaggtcgggc caaagaccta catccggcag gacaatgaga gggtactgtt tgcccccatg |
| cgcatggtga ccgtcccccc acgtcactac tgcacagtgg ccaaccctgt gtctcgggat |
| gcccagggct tggtgctgtt tgatgtcaca gggcaagttc ggcttcgcca cgctgacctc |
| gagatccggc tggcccagga ccccttcccc ctgtacccag gggaggtgct ggaaaaggac |
| atcacacccc tgcaggtggt tctgcccaac actgccctcc atctaaaggc gctgcttgat |
| tttgaggata aagatggaga caaggtggcg gcaggagatg agtggctttt cgagggacct |
| ggcacgtaca tcccccggaa ggaagtggag gtcgtggaga tcattcaggc caccatcatc |
| aggcagaacc aggctctgcg gctcagggcc cgcaaggagt gctgggaccg ggacggcaag |
| gagagggtga caggggaaga atggctggtc accacagtag gggcgtacct cccagcggtg |
| tttgaggagg ttctggattt ggtggacgcc gtcatcctta cggaaaagac agccctgcac |
| ctccgggctc ggcggaactt ccgggacttc aggggagtgt cccgccgcac tggggaggag |
| tggctggtaa cagtgcagga cacagaggcc cacgtgccag atgtccacga ggaggtgctg |
| ggggttgtgc ccatcaccac cctgggcccc cacaactact gcgtgattct cgaccctgtc |
| ggaccggatg gcaagaatca gctggggcag aagcgcgtgg tcaagggaga gaagtctttt |
| ttcctccagc caggagagca gctggaacaa ggcatccagg atgtgtatgt gctgtcggag |
| cagcaggggc tgctgctgag ggccctgcag cccctggagg agggggagga tgaggagaag |
| gtctcacacc aggctgggga ccactggctc atccgcggac ccctggagta tgtgccatct |
| gccaaagtgg aggtggtgga ggagcgccag gccatccctc tagacgagaa cgagggcatc |
| tatgtgcagg atgtcaagac cggaaaggtg cgcgctgtga ttggaagcac ctacatgctg |
| acccaggacg aagtcctgtg ggagaaagag ctgcctcccg gggtggagga gctgctgaac |
| aaggggcagg accctctggc agacaggggt gagaaggaca cagctaagag cctccagccc |
| ttggcgcccc ggaacaagac ccgtgtggtc agctaccgcg tgccccacaa cgctgcggtg |
| caggtgtacg actaccgaga gaagcgagcc cgcgtggtct tcgggcctga gccggtgtcg |
| ctgggtcctg aggagcagtt cacagtgttg tccctctcag ctgggcggcc caagcgtccc |
| catgcccgcc gtgcgctctg cctgctgctg gggcctgact tcttcacaga cgtcatcacc |
| atcgaaacgg cggatcatgc caggctgcaa ctgcagctgg cctacaactg gcactttgag |
| gtgaatgacc ggaaggaccc ccaagagacg gccaagctct tttcagtgcc agactttgta |
| ggtgatgcct gcaaagccat cgcatcccgg gtgcgggggg ccgtggcctc tgtcactttc |
| gatgacttcc ataagaactc agcccgcatc attcgcactg ctgtctttgg ctttgagacc |
| tcggaagcga agggccccga tggcatggcc ctgcccaggc cccgggacca ggctgtcttc |
| ccccaaaacg ggctggtggt cagcagtgtg gacgtgcagt cagtggagcc tgtggatcag |
| aggacccggg acgccctgca acgcagcgtc cagctggcca tcgagatcac caccaactcc |
| caggaagcgg cggccaagca tgaggctcag agactggagc aggaagcccg cggccggctt |
| gagcggcaga agatcctgga ccagtcagaa gccgagaaag ctcgcaagga acttttggag |
| ctggaggctc tgagcatggc cgtggagagc accgggactg ccaaggcgga ggccgagtcc |
| cgtgcggagg cagcccggat tgagggagaa gggtccgtgc tgcaggccaa gctaaaagca |
| caggccttgg ccattgaaac ggaggctgag ctccagaggg tccagaaggt ccgagagctg |
| gaactggtct atgcccgggc ccagctggag ctggaggtga gcaaggctca gcagctggct |
| gaggtggagg tgaagaagtt caagcagatg acagaggcca taggccccag caccatcagg |
| gaccttgctg tggctgggcc tgagatgcag gtaaaactgc tccagtccct gggcctgaaa |
| tcaaccctca tcaccgatgg ctccactccc atcaacctct tcaacacagc ctttgggctg |
| ctggggatgg ggcccgaggg tcagcccctg ggcagaaggg tggccagtgg gcccagccct |
| ggggagggga taccccccca gtctgctcag gcccctcaag ctcctggaga caaccacgtg |
| gtgcctgtac tgcgctaa |
| SEQ ID NO: 11 |
| TEP1, Genbank #AAC51107 |
| Met Glu Lys Leu His Gly His Val Ser Ala His Pro Asp Ile Leu Ser Leu Glu |
| Asn Arg Cys Leu Ala Met Leu Pro Asp Leu Gln Pro Leu Glu Lys Leu His Gln |
| His Val Ser Thr His Ser Asp Ile Leu Ser Leu Lys Asn Gln Cys Leu Ala Thr |
| Leu Pro Asp Leu Lys Thr Met Glu Lys Pro His Gly Tyr Val Ser Ala His Pro |
| Asp Ile Leu Ser Leu Glu Asn Gln Cys Leu Ala Thr Leu Ser Asp Leu Lys Thr |
| Met Glu Lys Pro His Gly His Val Ser Ala His Pro Asp Ile Leu Ser Leu Glu |
| Asn Arg Cys Leu Ala Thr Leu Pro Ser Leu Lys Ser Thr Val Ser Ala Ser Pro |
| Leu Phe Gln Ser Leu Gln Ile Ser His Met Thr Gln Ala Asp Leu Tyr Arg Val |
| Asn Asn Ser Asn Cys Leu Leu Ser Glu Pro Pro Ser Trp Arg Ala Gln His Phe |
| Ser Lys Gly Leu Asp Leu Ser Thr Cys Pro Ile Ala Leu Lys Ser Ile Ser Ala |
| Thr Glu Thr Ala Gln Glu Ala Thr Leu Gly Arg Trp Phe Asp Ser Glu Glu Lys |
| Lys Gly Ala Glu Thr Gln Met Pro Ser Tyr Ser Leu Ser Leu Gly Glu Glu Glu |
| Glu Val Glu Asp Leu Ala Val Lys Leu Thr Ser Gly Asp Ser Glu Ser His Pro |
| Glu Pro Thr Asp His Val Leu Gln Glu Lys Lys Met Ala Leu Leu Ser Leu Leu |
| Cys Ser Thr Leu Val Ser Glu Val Asn Met Asn Asn Thr Ser Asp Pro Thr Leu |
| Ala Ala Ile Phe Glu Ile Cys Arg Glu Leu Ala Leu Leu Glu Pro Glu Phe Ile |
| Leu Lys Ala Ser Leu Tyr Ala Arg Gln Gln Leu Asn val Arg Asn Val Ala Asn |
| Asn Ile Leu Ala Ile Ala Ala Phe Leu Pro Ala Cys Arg Pro His Leu Arg Arg |
| Tyr Phe Cys Ala Ile Val Gln Leu Pro Ser Asp Trp Ile Gln Val Ala Glu Leu |
| Tyr Gln Ser Leu Ala Glu Gly Asp Lys Asn Lys Leu Val Pro Leu Pro Ala Cys |
| Leu Arg Thr Ala Met Thr Asp Lys Phe Ala Gln Phe Asp Glu Tyr Gln Leu Ala |
| Lys Tyr Asn Pro Arg Lys His Arg Ala Lys Arg His Pro Arg Arg Pro Pro Arg |
| Ser Pro Gly Met Glu Pro Pro Phe Ser His Arg Cys Phe Pro Arg Tyr Ile Gly |
| Phe Leu Arg Glu Glu Gln Arg Lys Phe Glu Lys Ala Gly Asp Thr Val Ser Glu |
| Lys Lys Asn Pro Pro Arg Phe Thr Leu Lys Lys Leu Val Gln Arg Leu His Ile |
| His Lys Pro Ala Gln His Val Gln Ala Leu Leu Gly Tyr Arg Tyr Pro Ser Asn |
| Leu Gln Leu Phe Ser Arg Ser Arg Leu Pro Gly Pro Trp Asp Ser Ser Arg Ala |
| Gly Lys Arg Met Lys Leu Ser Arg Pro Glu Thr Trp Glu Arg Glu Leu Ser Leu |
| Arg Gly Asn Lys Ala Ser Val Trp Glu Glu Leu Ile Glu Asn Gly Lys Leu Pro |
| Phe Met Ala Met Leu Arg Asn Leu Cys Asn Leu Leu Arg Val Gly Ile Ser Ser |
| Arg His His Glu Leu Ile Leu Gln Arg Leu Gln His Gly Lys Ser Val Ile His |
| Ser Arg Gln Phe Pro Phe Arg Phe Leu Asn Ala His Asp Ala Ile Asp Ala Leu |
| Glu Ala Gln Leu Arg Asn Gln Ala Leu Pro Phe Pro Ser Asn Ile Thr Leu Met |
| Arg Arg Ile Leu Thr Arg Asn Glu Lys Asn Arg Pro Arg Arg Arg Phe Leu Cys |
| His Leu Ser Arg Gln Gln Leu Arg Met Ala Met Arg Ile Pro Val Leu Tyr Glu |
| Gln Leu Lys Arg Glu Lys Leu Arg Val His Lys Ala Arg Gln Trp Lys Tyr Asp |
| Gly Glu Met Leu Asn Arg Tyr Arg Gln Ala Leu Glu Thr Ala Val Asn Leu Ser |
| Val Lys His Ser Leu Pro Leu Leu Pro Gly Arg Thr Val Leu Val Tyr Leu Thr |
| Asp Ala Asn Ala Asp Arg Leu Cys Pro Lys Ser Asn Pro Gln Gly Pro Pro Leu |
| Asn Tyr Ala Leu Leu Leu Ile Gly Met Met Ile Thr Arg Ala Glu Gln Val Asp |
| Val Val Leu Cys Gly Gly Asp Thr Leu Lys Thr Ala Val Leu Lys Ala Glu Glu |
| Gly Ile Leu Lys Thr Ala Ile Lys Leu Gln Ala Gln Val Gln Glu Phe Asp Glu |
| Asn Asp Gly Trp Ser Leu Asn Thr Phe Gly Lys Tyr Leu Leu Ser Leu Ala Gly |
| Gln Arg Val Pro Val Asp Arg Val Ile Leu Leu Gly Gln Ser Met Asp Asp Gly |
| Met Ile Asn Val Ala Lys Gln Leu Tyr Trp Gln Arg Val Asn Ser Lys Cys Leu |
| Phe Val Gly Ile Leu Leu Arg Arg Val Gln Tyr Leu Ser Thr Asp Leu Asn Pro |
| Asn Asp Val Thr Leu Ser Gly Cys Thr Asp Ala Ile Leu Lys Phe Ile Ala Glu |
| His Gly Ala Ser His Leu Leu Glu His Val Gly Gln Met Asp Lys Ile Phe Lys |
| Ile Pro Pro Pro Pro Gly Lys Thr Gly Val Gln Ser Leu Arg Pro Leu Glu Glu |
| Asp Thr Pro Ser Pro Leu Ala Pro Val Ser Gln Gln Gly Trp Arg Ser Ile Arg |
| Leu Phe Ile Ser Ser Thr Phe Arg Asp Met His Gly Glu Arg Asp Leu Leu Leu |
| Arg Ser Val Leu Pro Ala Leu Gln Ala Arg Ala Ala Pro His Arg Ile Ser Leu |
| His Gly Ile Asp Leu Arg Trp Gly Val Thr Glu Glu Glu Thr Arg Arg Asn Arg |
| Gln Leu Glu Val Cys Leu Gly Glu Val Glu Asn Ala Gln Leu Phe Val Gly Ile |
| Leu Gly Ser Arg Tyr Gly Tyr Ile Pro Pro Ser Tyr Asn Leu Pro Asp His Pro |
| His Phe His Trp Ala Gln Gln Tyr Pro Ser Gly Arg Ser Val Thr Glu Met Glu |
| Val Met Gln Phe Leu Asn Arg Asn Gln Arg Leu Gln Pro Ser Ala Gln Ala Leu |
| Ile Tyr Phe Arg Asp Ser Ser Phe Leu Ser Ser Val Pro Asp Ala Trp Lys Ser |
| Asp Phe Val Ser Glu Ser Glu Glu Ala Ala Cys Arg Ile Ser Glu Leu Lys Ser |
| Tyr Leu Ser Arg Gln Lys Gly Ile Thr Cys Arg Arg Tyr Pro Cys Glu Trp Gly |
| Gly Val Ala Ala Gly Arg Pro Tyr Val Gly Gly Leu Glu Glu Phe Gly Gln Leu |
| Val Leu Gln Asp Val Trp Asn Met Ile Gln Lys Leu Tyr Leu Gln Pro Gly Ala |
| Leu Leu Glu Gln Pro Val Ser Ile Pro Asp Asp Asp Leu Val Gln Ala Thr Phe |
| Gln Gln Leu Gln Lys Pro Pro Ser Pro Ala Arg Pro Arg Leu Leu Gln Asp Thr |
| Val Gln Gln Leu Met Leu Pro His Gly Arg Leu Ser Leu Val Thr Gly Gln Ser |
| Gly Gln Gly Lys Thr Ala Phe Leu Ala Ser Leu Val Ser Ala Leu Gln Ala Pro |
| Asp Gly Ala Lys Val Ala Pro Leu Val Phe Phe His Phe Ser Gly Ala Arg Pro |
| Asp Gln Gly Leu Ala Leu Thr Leu Leu Arg Arg Leu Cys Thr Tyr Leu Arg Gly |
| Gln Leu Lys Glu Pro Gly Ala Leu Pro Ser Thr Tyr Arg Ser Leu Val Trp Glu |
| Leu Gln Gln Arg Leu Leu Pro Lys Ser Ala Glu Ser Leu His Pro Gly Gln Thr |
| Gln Val Leu Ile Ile Asp Gly Ala Asp Arg Leu Val Asp Gln Asn Gly Gln Leu |
| Ile Ser Asp Trp Ile Pro Lys Lys Leu Pro Arg Cys Val His Leu Val Leu Ser |
| Val Ser Ser Asp Ala Gly Leu Gly Glu Thr Leu Glu Gln Ser Gln Gly Ala His |
| Val Leu Ala Leu Gly Pro Leu Glu Ala Ser Ala Arg Ala Arg Leu Val Arg Glu |
| Glu Leu Ala Leu Tyr Gly Lys Arg Leu Glu Glu Ser Pro Phe Asn Asn Gln Met |
| Arg Leu Leu Leu Val Lys Arg Glu Ser Gly Arg Pro Leu Tyr Leu Arg Leu Val |
| Thr Asp His Leu Arg Leu Phe Thr Leu Tyr Glu Gln Val Ser Glu Arg Leu Arg |
| Thr Leu Pro Ala Thr Val Pro Leu Leu Leu Gln His Ile Leu Ser Thr Leu Glu |
| Lys Glu His Gly Pro Asp Val Leu Pro Gln Ala Leu Thr Ala Leu Glu Val Thr |
| Arg Ser Gly Leu Thr Val Asp Gln Leu His Gly Val Leu Ser Val Trp Arg Thr |
| Leu pro Lys Gly Thr Lys Ser Trp Glu Glu Ala Val Ala Ala Gly Asn Ser Gly |
| Asp Pro Tyr Pro Met Gly Pro Phe Ala Cys Leu Val Gln Ser Leu Arg Ser Leu |
| Leu Gly Glu Gly Pro Leu Glu Arg Pro Gly Ala Arg Leu Cys Leu Pro Asp Gly |
| Pro Leu Arg Thr Ala Ala Lys Arg Cys Tyr Gly Lys Arg Pro Gly Leu Glu Asp |
| Thr Ala His Ile Leu Ile Ala Ala Gln Leu Trp Lys Thr Cys Asp Ala Asp Ala |
| Ser Gly Thr Phe Arg Ser Cys Pro Pro Glu Ala Leu Gly Asp Leu Pro Tyr His |
| Leu Leu Gln Ser Gly Asn Arg Gly Leu Leu Ser Lys Phe Leu Thr Asn Leu His |
| Val Val Ala Ala His Leu Glu Leu Gly Leu Val Ser Arg Leu Leu Glu Ala His |
| Ala Leu Tyr Ala Ser Ser Val Pro Lys Glu Glu Gln Lys Leu Pro Glu Ala Asp |
| Val Ala Val Phe Arg Thr Phe Leu Arg Gln Gln Ala Ser Ile Leu Ser Gln Tyr |
| Pro Arg Leu Leu Pro Gln Gln Ala Ala Asn Gln Pro Leu Asp Ser Pro Leu Cys |
| His Gln Ala Ser Leu Leu Ser Arg Arg Trp His Leu Gln His Thr Leu Arg Trp |
| Leu Asn Lys Pro Arg Thr Met Lys Asn Gln Gln Ser Ser Ser Leu Ser Leu Ala |
| Val Ser Ser Ser Pro Thr Ala Val Ala Phe Ser Thr Asn Gly Gln Arg Ala Ala |
| Val Gly Thr Ala Asn Gly Thr Val Tyr Leu Leu Asp Leu Arg Thr Trp Gln Glu |
| Glu Lys Ser Val Val Ser Gly Cys Asp Gly Ile Ser Ala Cys Leu Phe Leu Ser |
| Asp Asp Thr Leu Phe Leu Thr Ala Phe Asp Gly Leu Leu Glu Leu Trp Asp Leu |
| Gln His Gly Cys Arg Val Leu Gln Thr Lys Ala His Gln Tyr Gln Ile Thr Gly |
| Cys Cys Leu Ser Pro Asp Cys Arg Leu Leu Ala Thr Val Cys Leu Gly Gly Cys |
| Leu Lys Leu Trp Asp Thr Val Arg Gly Gln Leu Ala Phe Gln His Thr Tyr Pro |
| Lys Ser Leu Asn Cys Val Ala Phe His Pro Glu Gly Gln Val Ile Ala Thr Gly |
| Ser Trp Ala Gly Ser Ile Ser Phe Phe Gln Val Asp Gly Leu Lys Val Thr Lys |
| Asp Leu Gly Ala Pro Gly Ala Ser Ile Arg Thr Leu Ala Phe Asn Val Pro Gly |
| Gly Val Val Ala Val Gly Arg Leu Asp Ser Met Val Glu Leu Trp Ala Trp Arg |
| Glu Gly Ala Arg Leu Ala Ala Phe Pro Ala His His Gly Phe Val Ala Ala Ala |
| Leu Phe Leu His Ala Gly Cys Gln Leu Leu Thr Ala Gly Glu Asp Gly Lys Val |
| Gln Val Trp Ser Gly Ser Leu Gly Arg Pro Arg Gly His Leu Gly Ser Leu Ser |
| Leu Ser Pro Ala Leu Ser Val Ala Leu Ser Pro Asp Gly Asp Arg Val Ala Val |
| Gly Tyr Arg Ala Asp Gly Ile Arg Ile Tyr Lys Ile Ser Ser Gly Ser Gln Gly |
| Ala Gln Gly Gln Ala Leu Asp Val Ala Val Ser Ala Leu Ala Trp Leu Ser Pro |
| Lys Val Leu Val Ser Gly Ala Glu Asp Gly Ser Leu Gln Gly Trp Ala Leu Lys |
| Glu Cys Ser Leu Gln Ser Leu Trp Leu Leu Ser Arg Phe Gln Lys Pro Val Leu |
| Gly Leu Ala Thr Ser Gln Glu Leu Leu Ala Ser Ala Ser Glu Asp Phe Thr Val |
| Gln Leu Trp Pro Arg Gln Leu Leu Thr Arg Pro His Lys Ala Glu Asp Phe Pro |
| Cys Gly Thr Glu Leu Arg Gly His Glu Gly Pro Val Ser Cys Cys Ser Phe Ser |
| Thr Asp Gly Gly Ser Leu Ala Thr Gly Gly Arg Asp Arg Ser Leu Leu Cys Trp |
| Asp Val Arg Thr Pro Lys Thr Pro Val Leu Ile His Ser Phe Pro Ala Cys His |
| Arg Asp Trp Val Thr Gly Cys Ala Trp Thr Lys Asp Asn Leu Leu Ile Ser Cys |
| Ser Ser Asp Gly Ser Val Gly Leu Trp Asp Pro Glu Ser Gly Gln Arg Leu Gly |
| Gln Phe Leu Gly His Gln Ser Ala Val Ser Ala Val Ala Ala Val Glu Glu His |
| Val Val Ser Val Ser Arg Asp Gly Thr Leu Lys Val Trp Asp His Gln Gly Val |
| Glu Leu Thr Ser Ile Pro Ala His Ser Gly Pro Ile Ser His Cys Ala Ala Ala |
| Met Glu Pro Arg Ala Ala Gly Gln Pro Gly Ser Glu Leu Leu Val Val Thr Val |
| Gly Leu Asp Gly Ala Thr Arg Leu Trp His Pro Leu Leu Val Cys Gln Thr His |
| Thr Leu Leu Gly His Ser Gly Pro Val Arg Ala Ala Ala Val Ser Glu Thr Ser |
| Gly Leu Met Leu Thr Ala Ser Glu Asp Gly Ser Val Arg Leu Trp Gln Val Pro |
| Lys Glu Ala Asp Asp Thr Cys Ile Pro Arg Ser Ser Ala Ala Val Thr Ala Val |
| Ala Trp Ala Pro Asp Gly Ser Met Ala Val Ser Gly Asn Gln Ala Gly Glu Leu |
| Ile Leu Trp Gln Glu Ala Lys Ala Val Ala Thr Ala Gln Ala Pro Gly His Ile |
| Gly Ala Leu Ile Trp Ser Ser Ala His Thr Phe Phe Val Leu Ser Ala Asp Glu |
| Lys Ile Ser Glu Trp Gln Val Lys Leu Arg Lys Gly Ser Ala Pro Gly Asn Leu |
| Ser Leu His Leu Asn Arg Ile Leu Gln Glu Asp Leu Gly Val Leu Thr Ser Leu |
| Asp Trp Ala Pro Asp Gly His Phe Leu Ile Leu Ala Lys Ala Asp Leu Lys Leu |
| Leu Cys Met Lys Pro Gly Asp Ala Pro Ser Glu Ile Trp Ser Ser Tyr Thr Glu |
| Asn Pro Met Ile Leu Ser Thr His Lys Glu Tyr Gly Ile Phe Val Leu Gln Pro |
| Lys Asp Pro Gly Val Leu Ser Phe Leu Arg Gln Lys Glu Ser Gly Glu Phe Glu |
| Glu Arg Leu Asn Phe Asp Ile Asn Leu Glu Asn Pro Ser Arg Thr Leu Ile Ser |
| Ile Thr Gln Ala Lys Pro Glu Ser Glu Ser Ser Phe Leu Cys Ala Ser Ser Asp |
| Gly Ile Leu Trp Asn Leu Ala Lys Cys Ser Pro Glu Gly Glu Trp Thr Thr Gly |
| Asn Met Trp Gln Lys Lys Ala Asn Thr Pro Glu Thr Gln Thr Pro Gly Thr Asp |
| Pro Ser Thr Cys Arg Glu Ser Asp Ala Ser Met Asp Ser Asp Ala Ser Met Asp |
| Ser Glu Pro Thr Pro His Leu Lys Thr Arg Gln Arg Arg Lys Ile His Ser Gly |
| Ser Val Thr Ala Leu His Val Leu Pro Glu Leu Leu Val Thr Ala Ser Lys Asp |
| Arg Asp Val Lys Leu Trp Glu Arg Pro Ser Met Gln Leu Leu Gly Leu Phe Arg |
| Cys Glu Gly Ser Val Ser Cys Leu Glu Pro Trp Leu Gly Ala Asn Ser Thr Leu |
| Gln Leu Ala Val Gly Asp Val Gln Gly Asn Val Tyr Phe Leu Asn Trp Glu |
| SEQ ID NO: 12 |
| TEP1 cDNA, Genbank #U86136 |
| atggaaaaac tccatgggca tgtgtctgcc catccagaca tcctctcctt ggagaaccgg |
| tgcctggcta tgctccctga cttacagccc ttggagaaac tacatcagca tgtatctacc |
| cactcagata tcctctcctt gaagaaccag tgcctagcca cgcttcctga cctgaagacc |
| atggaaaaac cacatggata tgtgtctgcc cacccagaca tcctctcctt ggagaaccag |
| tgcctggcca cactttctga cctgaagacc atggagaaac cacatggaca tgtttctgcc |
| cacccagaca tcctctcctt ggagaaccgg tgcctggcca ccctccctag tctaaagagc |
| actgtgtctg ccagcccctt gttccagagt ctacagatat ctcacatgac gcaagctgat |
| ttgtaccgtg tgaacaacag caattgcctg ctctctgagc ctccaagttg gagggctcag |
| catttctcta agggactaga cctttcaacc tgccctatag ccctgaaatc catctctgcc |
| acagagacag ctcaggaagc aactttgggt cgttggtttg attcagaaga gaagaaaggg |
| gcagagaccc aaatgccttc ttatagtctg agcttgggag aggaggagga ggtggaggat |
| ctggccgtga agctcacctc tggagactct gaatctcatc cagagcctac tgaccatgtc |
| cttcaggaaa agaagatggc tctactgagc ttgctgtgct ctactctggt ctcagaagta |
| aacatgaaca atacatctga ccccaccctg gctgccattt ttgaaatctg tcgtgaactt |
| gccctcctgg agcctgagtt tatcctcaag gcatctttgt atgccaggca gcagctgaac |
| gtccggaatg tggccaataa catcttggcc attgctgctt tcttgccggc gtgtcgcccc |
| cacctgcgac gatatttctg tgccattgtc cagctgcctt ctgactggat ccaggtggct |
| gagctttacc agagcctggc tgagggagat aagaataagc tggtgcccct gcccgcctgt |
| ctccgtactg ccatgacgga caaatttgcc cagtttgacg agtaccagct ggctaagtac |
| aaccctcgga agcaccgggc caagagacac ccccgccggc caccccgctc tccagggatg |
| gagcctccat tttctcacag atgttttcca aggtacatag ggtttctcag agaagagcag |
| agaaagtttg agaaggccgg tgatacagtg tcagagaaaa agaatcctcc aaggttcacc |
| ctgaagaagc tggttcagcg actgcacatc cacaagcctg cccagcacgt tcaagccctg |
| ctgggttaca gatacccctc caacctacag ctcttttctc gaagtcgcct tcctgggcct |
| tgggattcta gcagagctgg gaagaggatg aagctgtcta ggccagagac ctgggagcgg |
| gagctgagcc tacgggggaa caaagcgtcg gtctgggagg aactcattga aaatgggaag |
| cttcccttca tggccatgct tcggaacctg tgcaacctgc tgcgggttgg aatcagttcc |
| cgccaccatg agctcattct ccagagactc cagcatggga agtcggtgat ccacagtcgg |
| cagtttccat tcagatttct taacgcccat gatgccattg atgccctcga ggctcaactc |
| agaaatcaag cattgccctt tccttcgaat ataacactga tgaggcggat actaactaga |
| aatgaaaaga accgtcccag gcggaggttt ctttgccacc taagccgtca gcagcttcgt |
| atggcaatga ggatacctgt gttgtatgag cagctcaaga gggagaagct gagagtacac |
| aaggccagac agtggaaata tgatggtgag atgctgaaca ggtaccgaca ggccctagag |
| acagctgtga acctctctgt gaagcacagc ctgcccctgc tgccaggccg cactgtcttg |
| gtctatctga cagatgctaa tgcagacagg ctctgtccaa agagcaaccc acaagggccc |
| ccgctgaact atgcactgct gttgattggg atgatgatca cgagggcgga gcaggtggac |
| gtcgtgctgt gtggaggtga cactctgaag actgcagtgc ttaaggcaga agaaggcatc |
| ctgaagactg ccatcaagct ccaggctcaa gtccaggagt ttgatgaaaa tgatggatgg |
| tccctgaata cttttgggaa atacctgctg tctctggctg gccaaagggt tcctgtggac |
| agggtcatcc tccttggcca aagcatggat gatggaatga taaatgtggc caaacagctt |
| tactggcagc gtgtgaattc caagtgcctc tttgttggta tcctcctaag aagggtacaa |
| tacctgtcaa cagatttgaa tcccaatgat gtgacactct caggctgtac tgatgcgata |
| ctgaagttca ttgcagagca tggggcctcc catcttctgg aacatgtggg ccaaatggac |
| aaaatattca agattccacc acccccagga aagacagggg tccagtctct ccggccactg |
| gaagaggaca ctccaagccc cttggctcct gtttcccagc aaggatggcg cagcatccgg |
| cttttcattt catccacttt ccgagacatg cacggggagc gggacctgct gctgaggtct |
| gtgctgccag cactgcaggc ccgagcggcc cctcaccgta tcagccttca cggaatcgac |
| ctccgctggg gcgtcactga ggaggagacc cgtaggaaca gacaactgga agtgtgcctt |
| ggggaggtgg agaacgcaca gctgtttgtg gggattctgg gctcccgtta tggatacatt |
| ccccccagct acaaccttcc tgaccatcca cacttccact gggcccagca gtacccttca |
| gggcgctctg tgacagagat ggaggtgatg cagttcctga accggaacca acgtctgcag |
| ccctctgccc aagctctcat ctacttccgg gattccagct tcctcagctc tgtgccagat |
| gcctggaaat ctgactttgt ttctgagtct gaagaggccg catgtcggat ctcagaactg |
| aagagctacc taagcagaca gaaagggata acctgccgca gatacccctg tgagtggggg |
| ggtgtggcag ctggccggcc ctatgttggc gggctggagg agtttgggca gttggttctg |
| caggatgtat ggaatatgat ccagaagctc tacctgcagc ctggggccct gctggagcag |
| ccagtgtcca tcccagacga tgacttggtc caggccacct tccagcagct gcagaagcca |
| ccgagtcctg cccggccacg ccttcttcag gacacagtgc aacagctgat gctgccccac |
| ggaaggctga gcctggtgac ggggcagtca ggacagggca agacagcctt cctggcatct |
| cttgtgtcag ccctgcaggc tcctgatggg gccaaggtgg caccattagt cttcttccac |
| ttttctgggg ctcgtcctga ccagggtctt gccctcactc tgctcagacg cctctgtacc |
| tatctgcgtg gccaactaaa agagccaggt gccctcccca gcacctaccg aagcctggtg |
| tgggagctgc agcagaggct gctgcccaag tctgctgagt ccctgcatcc tggccagacc |
| caggtcctga tcatcgatgg ggctgatagg ttagtggacc agaatgggca gctgatttca |
| gactggatcc caaagaagct tccccggtgt gtacacctgg tgctgagtgt gtctagtgat |
| gcaggcctag gggagaccct tgagcagagc cagggtgccc acgtgctggc cttggggcct |
| ctggaggcct ctgctcgggc ccggctggtg agagaggagc tggccctgta cgggaagcgg |
| ctggaggagt caccatttaa caaccagatg cgactgctgc tggtgaagcg ggaatcaggc |
| cggccgctct acctgcgctt ggtcaccgat cacctgaggc tcttcacgct gtatgagcag |
| gtgtctgaga gactccggac cctgcctgcc actgtccccc tgctgctgca gcacatcctg |
| agcacactgg agaaggagca cgggcctgat gtccttcccc aggccttgac tgccctagaa |
| gtcacacgga gtggtttgac tgtggaccag ctgcacggag tgctgagtgt gtggcggaca |
| ctaccgaagg ggactaagag ctgggaagaa gcagtggctg ctggtaacag tggagacccc |
| taccccatgg gcccgtttgc ctgcctcgtc cagagtctgc gcagtttgct aggggagggc |
| cctctggagc gccctggtgc ccggctgtgc ctccctgatg ggcccctgag aacagcagct |
| aaacgttgct atgggaagag gccagggcta gaggacacgg cacacatcct cattgcagct |
| cagctctgga agacatgtga cgctgatgcc tcaggcacct tccgaagttg ccctcctgag |
| gctctgggag acctgcctta ccacctgctc cagagcggga accgtggact tctttcgaag |
| ttccttacca acctccatgt ggtggctgca cacttggaat tgggtctggt ctctcggctc |
| ttggaggccc atgccctcta tgcttcttca gtccccaaag aggaacaaaa gctccccgag |
| gctgacgttg cagtgtttcg caccttcctg aggcagcagg cttcaatcct cagccagtac |
| ccccggctcc tgccccagca ggcagccaac cagcccctgg actcacctct ttgccaccaa |
| gcctcgctgc tctcccggag atggcacctc caacacacac tacgatggct taataaaccc |
| cggaccatga aaaatcagca aagctccagc ctgtctctgg cagtttcctc atcccctact |
| gctgtggcct tctccaccaa tgggcaaaga gcagctgtgg gcactgccaa tgggacagtt |
| tacctgttgg acctgagaac ttggcaggag gagaagtctg tggtgagtgg ctgtgatgga |
| atctctgctt gtttgttcct ctccgatgat acactctttc ttactgcctt cgacgggctc |
| ctggagctct gggacctgca gcatggttgt cgggtgctgc agactaaggc tcaccagtac |
| caaatcactg gctgctgcct gagcccagac tgccggctgc tagccaccgt gtgcttggga |
| ggatgcctaa agctgtggga cacagtccgt gggcagctgg ccttccagca cacctacccc |
| aagtccctga actgtgttgc cttccaccca gaggggcagg taatagccac aggcagctgg |
| gctggcagca tcagcttctt ccaggtggat gggctcaaag tcaccaagga cctgggggca |
| cccggagcct ctatccgtac cttggccttc aatgtgcctg ggggggttgt ggctgtgggc |
| cggctggaca gtatggtgga gctgtgggcc tggcgagaag gggcacggct ggctgccttc |
| cctgcccacc atggctttgt tgctgctgcg cttttcctgc atgcgggttg ccagttactg |
| acggctggag aggatggcaa ggttcaggtg tggtcagggt ctctgggtcg gccccgtggg |
| cacctgggtt ccctttctct ctctcctgcc ctctctgtgg cactcagccc agatggtgat |
| cgggtggctg ttggatatcg agcggatggc attaggatct acaaaatctc ttcaggttcc |
| cagggggctc agggtcaggc actggatgtg gcagtgtccg ccctggcctg gctaagcccc |
| aaggtattgg tgagtggtgc agaagatggg tccttgcagg gctgggcact caaggaatgc |
| tcccttcagt ccctctggct cctgtccaga ttccagaagc ctgtgctagg actggccact |
| tcccaggagc tcttggcttc tgcctcagag gatttcacag tgcagctgtg gccaaggcag |
| ctgctgacgc ggccacacaa ggcagaagac tttccctgtg gcactgagct gcggggacat |
| gagggccctg tgagctgctg tagtttcagc actgatggag gcagcctggc caccgggggc |
| cgggatcgga gtctcctctg ctgggacgtg aggacaccca aaacccctgt tttgatccac |
| tccttccctg cctgtcaccg tgactgggtc actggctgtg cctggaccaa agataaccta |
| ctgatatcct gctccagtga tggctctgtg gggctctggg acccagagtc aggacagcgg |
| cttggtcagt tcctgggtca tcagagtgct gtgagcgctg tggcagctgt ggaggagcac |
| gtggtgtctg tgagccggga tgggaccttg aaagtgtggg accatcaagg cgtggagctg |
| accagcatcc ctgctcactc aggacccatt agccactgtg cagctgccat ggagccccgt |
| gcagctggac agcctgggtc agagcttctg gtggtaaccg tcgggctaga tggggccaca |
| cggttatggc atccactctt ggtgtgccaa acccacaccc tcctgggaca cagcggccca |
| gtccgtgctg ctgctgtttc agaaacctca ggcctcatgc tgaccgcctc tgaggatggt |
| tctgtacggc tctggcaggt tcctaaggaa gcagatgaca catgtatacc aaggagttct |
| gcagccgtca ctgctgtggc ttgggcacca gatggttcca tggcagtatc tggaaatcaa |
| gctggggaac taatcttgtg gcaggaagct aaggctgtgg ccacagcaca ggctccaggc |
| cacattggtg ctctgatctg gtcctcggca cacacctttt ttgtcctcag tgctgatgag |
| aaaatcagcg agtggcaagt gaaactgcgg aagggttcgg cacccggaaa tttgagtctt |
| cacctgaacc gaattctaca ggaggactta ggggtgctga caagtctgga ttgggctcct |
| gatggtcact ttctcatctt ggccaaagca gatttgaagt tactttgcat gaagccaggg |
| gatgctccat ctgaaatctg gagcagctat acagaaaatc ctatgatatt gtccacccac |
| aaggagtatg gcatatttgt cctgcagccc aaggatcctg gagttctttc tttcttgagg |
| caaaaggaat caggagagtt tgaagagagg ctgaactttg atataaactt agagaatcct |
| agtaggaccc taatatcgat aactcaagcc aaacctgaat ctgagtcctc atttttgtgt |
| gccagctctg atgggatcct atggaacctg gccaaatgca gcccagaagg agaatggacc |
| acaggtaaca tgtggcagaa aaaagcaaac actccagaaa cccaaactcc agggacagac |
| ccatctacct gcagggaatc tgatgccagc atggatagtg atgccagcat ggatagtgag |
| ccaacaccac atctaaagac acggcagcgt agaaagattc actcgggctc tgtcacagcc |
| ctccatgtgc tacctgagtt gctggtgaca gcttcgaagg acagagatgt taagctatgg |
| gagagaccca gtatgcagct gctgggcctg ttccgatgcg aagggtcagt gagctgcctg |
| gaaccttggc tgggcgctaa ctccaccctg cagcttgccg tgggagacgt gcagggcaat |
| gtgtactttc tgaattggga atga |
| SEQ ID NO: 13 |
| vRNA, Genbank #AF045143 |
| ggcuggcuuu agcucagcgg uuacuucgac aguucuuuaa uugaaacaag caaccugucu |
| ggguuguucg agacccgcgg gcgcucucca guccuuuu |
| SEQ ID NO: 14 |
| vRNA, Genbank #AF045144 |
| ggcuggcuuu agcucagcgg uuacuucgag uacauuguaa ccaccucucu gggugguucg |
| agacccgcgg gugcuuucca gcucuuuu |
| SEQ ID NO: 15 |
| vRNA, Genbank #AF045145 |
| ggcuggcuuu agcucagcgg uuacuucgcg ugucaucaaa ccaccucucu ggguuguucg |
| agacccgcgg gcgcucucca gcccucuu |
| SEQ ID NO: 16 |
| mINT protein sequence (residues 1473-1724 of human |
| VPARP protein sequence) |
| Ala Asn Leu Arg Leu Pro Met Ala Ser Ala Leu Pro Glu Ala Leu Cys Ser Gln |
| Ser Arg Thr Thr Pro Val Asp Leu Cys Leu Leu Glu Glu Ser Val Gly Ser Leu |
| Glu Gly Ser Arg Cys Pro Val Phe Ala Phe Gln Ser Ser Asp Thr Glu Ser Asp |
| Glu Leu Ser Glu Val Leu Gln Asp Ser Cys Phe Leu Gln Ile Lys Cys Asp Thr |
| Lys Asp Asp Ser Ile Pro Cys Phe Leu Glu Leu Lys Glu Glu Asp Glu Ile Val |
| Cys Thr Gln His Trp Gln Asp Ala Val Pro Trp Thr Glu Leu Leu Ser Leu Gln |
| Thr Glu Asp Gly Phe Trp Lys Leu Thr Pro Glu Leu Gly Leu Ile Leu Asn Leu |
| Asn Thr Asn Gly Leu His Ser Phe Leu Lys Gln Lys Gly Ile Gln Ser Leu Gly |
| Val Lys Gly Arg Glu Cys Leu Leu Asp Leu Ile Ala Thr Met Leu Val Leu Gln |
| Phe Ile Arg Thr Arg Leu Glu Lys Glu Gly Ile Val Phe Lys Ser Leu Met Lys |
| Met Asp Asp Pro Ser Ile Ser Arg Asn Ile Pro Trp Ala Phe Glu Ala Ile Lys |
| Gln Ala Ser Glu Trp Val Arg Arg Thr Glu Gly Gln Tyr Pro Ser Ile Cys Pro |
| Arg Leu Glu Leu Gly Asn Asp Trp Asp Ser Ala Thr Lys Gln Leu Leu Gly Leu |
| Gln Pro Ile Ser Thr Val Ser Pro Leu His Arg Val Leu His Tyr Ser Gln Gly |
Claims
1. A vault complex comprising a cell adhesion modifying substance.
2. The vault complex of claim 1, wherein the cell adhesion modifying substance inhibits integrin binding.
3. The vault complex of claim 2, wherein the cell adhesion modifying substance is an RGD-containing peptide.
4. The vault complex of claim 3, wherein the RGD-containing peptide is cyclic.
5. The vault complex of claim 4, wherein the RGD-containing peptide is GRGDSP (SEQ ID NO: 17).
6. The vault complex of claim 4, wherein the cyclic RGD-containing peptide is attached to mINT.
7. The vault complex of claim 1, wherein the vault complex comprises MVP or modified MVP.
8. The vault complex of claim 1, wherein the vault complex further comprises VPARP or modified VPARP, or a portion of VARP or a modified portion of VPARP.
9. A pharmaceutical composition for treating and/or preventing chronic kidney disease in a subject, comprising a cell adhesion modifying substance incorporated within a vault complex, and at least one pharmaceutically acceptable excipient.
10. The pharmaceutical composition of claim 9, wherein the cell adhesion modifying substance inhibits integrin binding.
11. The pharmaceutical composition of claim 9, wherein the cell adhesion modifying substance is an RGD-containing peptide.
12. The pharmaceutical composition of claim 11, wherein the RGD-containing peptide is cyclic.
13. The pharmaceutical composition of claim 12, wherein the RGD-containing peptide is GRGDSP (SEQ ID NO: 17).
14. The pharmaceutical composition of claim 12, wherein the cyclic RGD-containing peptide is attached to mINT.
15. The pharmaceutical composition of claim 9, wherein the vault complex comprises MVP or modified MVP.
16. The pharmaceutical composition of claim 9, wherein the vault complex further comprises VPARP or modified VPARP, or a portion of VARP or a modified portion of VPARP.
17. A method of treating and/or preventing chronic kidney disease in a subject, comprising administering to the subject an effective amount of a cell adhesion modifying substance incorporated within a vault complex.
18. The method of claim 17, wherein the cell adhesion modifying substance inhibits integrin binding.
19. The method of claim 17, wherein the cell adhesion modifying substance is an RGD-containing peptide.
20. The method of claim 19, wherein the RGD-containing peptide is cyclic.
21. The method of claim 20, wherein the RGD-containing peptide is GRGDSP (SEQ ID NO: 17).
22. The method of claim 20, wherein the cyclic RGD-containing peptide is attached to mINT.
23. The method of claim 17, wherein the vault complex comprises MVP or modified MVP.
24. The method of claim 17, wherein the vault complex further comprises VPARP or modified VPARP, or a portion of VARP or a modified portion of VPARP.
25. The chronic kidney disease of claim 17, wherein the disease is caused by diabetic nephropathy.